F497409

General Info

Members Datasets Scaffolds Average Seq Length
4014 1274 3629 91

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10017276|rootH1_100172762
Length 103
Sequence VPRSLKKGPFIDLHLIKKVEAAIASNDRRPIKTWSRRSMIMPEMVGLTLAVHNGRQHVPVLVNEEMVGHKLGEFAATRTYRGHAADKKAKKXXXVGAKSAFGC

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
5 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
6 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
7 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
8 2511231004 Pseudomonas sp. GM102 Isolate Nodule
9 2511231006 Pseudomonas sp. GM17 Isolate Nodule
10 2511231007 Pseudomonas sp. GM18 Isolate Nodule
11 2511231008 Pseudomonas sp. GM21 Isolate Nodule
12 2511231010 Pseudomonas sp. GM25 Isolate Nodule
13 2511231011 Pseudomonas sp. GM30 Isolate Nodule
14 2511231012 Pseudomonas sp. GM33 Isolate Nodule
15 2511231014 Pseudomonas sp. GM48 Isolate Nodule
16 2511231015 Pseudomonas sp. GM49 Isolate Nodule
17 2511231016 Pseudomonas sp. GM50 Isolate Nodule
18 2511231017 Pseudomonas sp. GM55 Isolate Nodule
19 2511231018 Pseudomonas sp. GM60 Isolate Nodule
20 2511231019 Pseudomonas sp. GM67 Isolate Nodule
21 2511231020 Pseudomonas sp. GM74 Isolate Nodule
22 2511231021 Pseudomonas sp. GM78 Isolate Nodule
23 2511231022 Pseudomonas sp. GM79 Isolate Nodule
24 2511231023 Pseudomonas sp. GM80 Isolate Nodule
25 2511231024 Pseudomonas sp. GM84 Isolate Nodule
26 2511231031 Pseudomonas sp. GM16 Isolate Nodule
27 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
28 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
29 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
30 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
31 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
32 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
33 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
34 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
35 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
36 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
37 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
38 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
39 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
40 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
41 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
42 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
43 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
44 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
45 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
46 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
47 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
48 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
49 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
50 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
51 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
52 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
53 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
54 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
55 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
56 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
57 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
58 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
59 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
60 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
61 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
62 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
63 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
64 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
65 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
66 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
67 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
68 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
69 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
70 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
71 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
72 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
73 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
74 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
75 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
76 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
77 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
78 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
79 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
80 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
81 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
82 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
83 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
84 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
85 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
86 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
87 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
88 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
89 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
90 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
91 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
92 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
93 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
94 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
95 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
96 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
97 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
98 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
99 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
100 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
101 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
102 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
103 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
104 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
105 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
106 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
107 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
108 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
109 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
110 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
111 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
112 2643221559 Lysobacter sp. Root559 Isolate Unclassified
113 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
114 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
115 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
116 2643221573 Lysobacter sp. Root604 Isolate Unclassified
117 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
118 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
119 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
120 2643221586 Lysobacter sp. Root667 Isolate Unclassified
121 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
122 2643221593 Lysobacter sp. Root690 Isolate Unclassified
123 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
124 2643221612 Lysobacter sp. Root76 Isolate Unclassified
125 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
126 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
127 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
128 2643221658 Variovorax sp. Root411 Isolate Unclassified
129 2643221672 Variovorax sp. Root434 Isolate Unclassified
130 2643221683 Variovorax sp. Root473 Isolate Unclassified
131 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
132 2643221695 Lysobacter sp. Root494 Isolate Unclassified
133 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
134 2643221720 Lysobacter sp. Root916 Isolate Unclassified
135 2643221727 Lysobacter sp. Root96 Isolate Unclassified
136 2643221728 Lysobacter sp. Root983 Isolate Unclassified
137 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
138 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
139 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
140 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
141 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
142 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
143 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
144 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
145 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
146 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
147 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
148 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
149 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
150 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
151 2734482264 Dyella sp. AD052 Isolate Unclassified
152 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
153 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
154 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
155 2738541277 Variovorax sp. GV051 Isolate Unclassified
156 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
157 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
158 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
159 2738541307 Variovorax sp. GV008 Isolate Unclassified
160 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
161 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
162 2738543009 Luteibacter sp. OK325 Isolate Unclassified
163 2738543013 Variovorax sp. BT01 Isolate Unclassified
164 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
165 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
166 2738543019 Variovorax sp. GV040 Isolate Unclassified
167 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
168 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
169 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
170 2739367700 Dyella sp. YR388 Isolate Unclassified
171 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
172 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
173 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
174 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
175 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
176 2765235841 Pseudomonas putida AA7 Isolate Unclassified
177 2773857670 Pseudomonas sp. 478 Isolate Unclassified
178 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
179 2773857673 Pseudomonas sp. 443 Isolate Unclassified
180 2784132063 Pseudomonas sp. 424 Isolate Unclassified
181 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
182 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
183 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
184 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
185 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
186 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
187 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
188 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
189 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
190 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
191 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
192 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
193 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
194 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
195 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
196 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
197 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
198 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
199 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
200 2818991446 Variovorax sp. 1180 Isolate Unclassified
201 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
202 2818991457 Xanthomonas translucens 569 Isolate Unclassified
203 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
204 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
205 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
206 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
207 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
208 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
209 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
210 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
211 2842677519 Variovorax sp. R-72495 Isolate Unclassified
212 2842733646 Variovorax sp. R-72446 Isolate Unclassified
213 2842747753 Variovorax sp. R-72060 Isolate Unclassified
214 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
215 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
216 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
217 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
218 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
219 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
220 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
221 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
222 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
223 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
224 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
225 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
226 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
227 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
228 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
229 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
230 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
231 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
232 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
233 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
234 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
235 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
236 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
237 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
238 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
239 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
240 2884411467 Dyella sp. AD56 Isolate Rhizosphere
241 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
242 2885198086 Variovorax sp. 679 Isolate Unclassified
243 2885211737 Variovorax sp. 553 Isolate Unclassified
244 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
245 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
246 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
247 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
248 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
249 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
250 2899924645 Variovorax sp. 369 Isolate Unclassified
251 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
252 2904456579 Variovorax sp. 2002 Isolate Unclassified
253 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
254 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
255 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
256 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
257 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
258 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
259 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
260 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
261 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
262 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
263 2919085039 Luteibacter sp. 1214 Isolate Unclassified
264 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
265 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
266 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
267 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
268 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
269 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
270 2919404418 Luteibacter sp. 3190 Isolate Unclassified
271 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
272 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
273 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
274 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
275 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
276 2919513703 Luteimonas sp. 3794 Isolate Unclassified
277 2919675420 Luteimonas terrae 4099 Isolate Unclassified
278 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
279 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
280 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
281 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
282 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
283 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
284 2928037797 Variovorax sp. 1126 Isolate Unclassified
285 2928044640 Variovorax sp. 1128 Isolate Unclassified
286 2928051484 Variovorax sp. 1133 Isolate Unclassified
287 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
288 2928070936 Variovorax gossypii 1167 Isolate Unclassified
289 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
290 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
291 2928963466 Dyella japonica 1073 Isolate Unclassified
292 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
293 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
294 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
295 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
296 2929520902 Variovorax beijingensis 502 Isolate Unclassified
297 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
298 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
299 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
300 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
301 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
302 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
303 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
304 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
305 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
306 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
307 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
308 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
309 2941471342 Luteibacter sp. 621 Isolate Unclassified
310 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
311 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
312 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
313 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
314 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
315 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
316 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
317 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
318 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
319 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
320 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
321 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
322 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
323 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
324 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
325 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
326 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
327 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
328 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
329 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
330 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
331 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
332 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
333 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
334 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
335 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
336 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
337 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
338 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
339 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
340 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
341 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
342 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
343 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
344 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
345 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
346 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
347 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
348 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
349 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
350 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
351 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
352 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
353 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
354 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
355 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
356 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
357 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
358 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
359 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
360 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
361 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
362 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
363 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
364 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
365 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
366 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
367 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
368 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
369 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
370 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
371 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
372 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
373 3300002865 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
374 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
375 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
376 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
377 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
378 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
379 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
380 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
381 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
382 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
383 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
384 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
385 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
386 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
387 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
388 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
389 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
390 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
391 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
392 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
393 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
394 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
395 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
396 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
397 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
398 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
399 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
400 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
401 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
402 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
403 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
404 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
405 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
406 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
407 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
409 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
410 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
411 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
412 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
413 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
414 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
415 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
416 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
417 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
418 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
419 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
420 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
421 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
422 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
423 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
424 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
425 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
426 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
427 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
428 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
429 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
430 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
431 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
432 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
435 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
437 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
438 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
439 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
440 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
441 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
442 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
443 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
444 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
445 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
446 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
447 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
448 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
449 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
450 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
451 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
452 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
453 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
454 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
455 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
456 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
457 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
458 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
459 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
460 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
461 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
462 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
463 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
464 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
465 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
466 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
467 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
468 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
469 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
470 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
471 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
472 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
473 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
474 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
475 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
476 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
477 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
478 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
479 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
480 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
481 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
482 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
483 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
484 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
485 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
486 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
487 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
488 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
489 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
490 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
491 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
492 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
493 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
494 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
495 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
496 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
497 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
498 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
499 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
500 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
501 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
502 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
503 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
504 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
505 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
506 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
507 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
508 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
509 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
510 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
511 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
512 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
513 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
514 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
515 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
516 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
517 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
518 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
519 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
520 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
521 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
522 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
523 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
524 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
525 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
526 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
527 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
528 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
529 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
530 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
531 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
532 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
533 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
534 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
535 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
536 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
537 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
538 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
539 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
540 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
541 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
542 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
543 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
544 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
545 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
546 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
547 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
548 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
549 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
550 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
551 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
552 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
553 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
554 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
555 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
556 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
557 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
558 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
559 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
560 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
561 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
562 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
563 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
564 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
565 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
566 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
567 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
568 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
569 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
570 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
571 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
572 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
573 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
574 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
575 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
576 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
577 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
578 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
579 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
580 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
581 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
582 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
583 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
584 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
585 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
586 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
587 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
588 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
589 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
590 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
591 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
592 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
593 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
594 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
595 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
596 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
597 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
598 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
599 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
600 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
601 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
602 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
603 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
604 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
605 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
606 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
608 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
609 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
610 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
611 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
612 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
613 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
614 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
615 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
616 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
618 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
619 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
620 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
621 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
622 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
623 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
624 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
625 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
626 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
627 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
628 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
629 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
630 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
631 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
632 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
633 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
634 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
635 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
636 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
637 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
638 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
639 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
640 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
641 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
642 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
643 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
644 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
645 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
646 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
647 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
648 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
649 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
650 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
651 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
652 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
653 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
654 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
655 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
656 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
657 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
658 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
659 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
660 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
661 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
662 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
663 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
664 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
665 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
666 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
667 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
668 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
669 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
670 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
671 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
672 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
673 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
674 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
675 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
676 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
677 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
678 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
679 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
680 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
681 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
682 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
683 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
684 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
685 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
687 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
688 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
689 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
690 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
691 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
692 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
693 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
694 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
695 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
696 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
697 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
698 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
699 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
700 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
701 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
702 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
703 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
704 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
705 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
706 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
707 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
708 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
709 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
710 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
711 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
712 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
713 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
714 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
715 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
716 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
717 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
718 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
719 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
720 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
721 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
722 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
723 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
724 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
725 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
726 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
727 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
728 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
729 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
730 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
731 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
732 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
733 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
734 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
735 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
736 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
737 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
738 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
739 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
740 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
741 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
742 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
743 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
744 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
745 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
746 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
747 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
748 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
749 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
750 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
751 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
752 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
753 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
754 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
755 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
756 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
757 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
758 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
759 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
760 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
761 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
762 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
763 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
764 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
765 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
766 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
767 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
768 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
769 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
770 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
771 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
772 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
773 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
774 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
775 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
776 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
777 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
778 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
779 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
780 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
781 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
782 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
783 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
784 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
785 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
786 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
787 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
788 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
789 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
790 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
791 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
792 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
793 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
794 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
795 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
796 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
797 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
798 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
799 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
800 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
801 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
802 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
803 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
804 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
805 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
806 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
807 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
808 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
809 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
810 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
811 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
812 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
813 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
814 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
815 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
816 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
817 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
818 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
819 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
820 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
821 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
822 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
823 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
824 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
825 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
826 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
827 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
828 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
829 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
830 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
831 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
832 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
833 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
834 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
835 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
836 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
837 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
838 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
839 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
840 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
841 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
842 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
843 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
844 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
845 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
846 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
847 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
848 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
849 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
850 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
851 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
852 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
853 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
854 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
855 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
856 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
857 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
858 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
859 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
860 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
861 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
862 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
863 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
864 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
865 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
866 3300041454 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT Metatranscriptome Rhizoplane
867 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
868 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
869 3300041457 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaT Metatranscriptome Rhizoplane
870 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
871 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
872 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
873 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
874 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
875 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
876 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
877 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
878 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
879 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
880 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
881 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
882 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
883 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
884 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
885 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
886 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
887 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
888 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
889 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
890 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
891 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
892 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
893 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
894 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
895 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
896 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
897 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
898 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
899 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
900 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
901 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
902 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
903 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
904 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
905 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
906 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
907 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
908 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
909 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
910 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
911 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
912 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
913 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
914 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
915 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
916 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
917 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
918 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
919 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
920 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
921 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
922 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
923 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
924 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
925 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
926 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
927 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
928 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
929 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
930 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
931 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
932 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
933 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
934 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
935 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
936 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
937 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
938 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
939 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
940 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
941 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
942 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
943 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
944 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
945 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
946 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
947 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
948 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
949 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
950 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
951 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
952 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
953 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
954 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
955 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
956 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
957 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
958 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
959 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
960 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
961 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
962 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
963 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
964 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
965 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
966 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
967 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
968 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
969 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
970 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
971 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
972 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
973 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
974 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
975 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
976 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
977 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
978 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
979 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
980 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
981 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
982 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
983 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
984 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
985 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
986 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
987 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
988 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
989 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
990 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
991 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
992 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
993 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
994 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
995 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
996 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
997 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
998 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
999 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
1000 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
1001 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
1002 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1003 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1004 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1005 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1006 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
1007 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1008 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1009 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1010 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1011 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1012 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1013 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1014 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
1015 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1016 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1017 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1018 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1019 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1020 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1021 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1022 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1023 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1024 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1025 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1026 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1027 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1028 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1029 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1030 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1031 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1032 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1033 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1034 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
1035 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1036 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1037 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1038 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1039 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1040 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1041 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1042 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1043 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1044 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1045 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1046 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1047 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
1048 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
1049 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
1050 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
1051 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
1052 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1053 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1054 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1055 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1056 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1057 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1058 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1059 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1060 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1061 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1062 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1063 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1064 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1065 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1066 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1067 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1068 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1069 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1070 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1071 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1072 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1073 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1074 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1075 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1076 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1077 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1078 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1079 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1080 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1081 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1082 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1083 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1084 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1085 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1086 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1087 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1088 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1089 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1090 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1091 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1092 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1093 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1094 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1095 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1096 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1097 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1098 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1099 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1100 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
1103 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
1104 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
1105 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
1106 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
1107 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
1108 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
1109 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
1110 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
1111 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
1112 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
1113 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
1114 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
1115 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
1116 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
1117 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
1118 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
1119 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
1120 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
1121 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
1122 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
1123 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
1124 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
1125 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
1126 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
1127 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
1128 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
1129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1132 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1133 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
1134 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
1135 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
1136 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
1137 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
1138 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
1139 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
1140 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
1141 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
1142 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
1143 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
1144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1147 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
1148 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
1149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1161 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1162 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1163 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1165 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
1166 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1167 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
1168 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
1169 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1170 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
1171 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
1172 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1173 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
1174 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
1175 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1176 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
1177 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1179 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
1180 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1181 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1182 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
1183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1184 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1185 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1186 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
1187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1190 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
1191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
1192 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1193 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1194 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1195 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1196 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1197 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1198 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1199 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1200 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1201 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1202 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1203 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1204 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1205 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1206 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1207 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1208 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1209 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1210 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1211 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1212 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1213 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1214 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1215 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1216 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1217 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1218 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1219 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1220 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1221 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1222 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1223 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1224 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1225 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1226 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1227 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1228 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1229 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1230 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1231 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1232 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1233 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1234 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1235 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1239 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
1240 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
1241 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
1242 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
1243 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
1244 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
1245 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
1246 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
1247 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1248 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
1249 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
1250 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
1251 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
1252 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
1253 8052494512 Pseudomonas putida LD6 Isolate Unclassified
1254 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
1255 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
1256 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
1257 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
1258 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
1259 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
1260 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
1261 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
1262 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
1263 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
1264 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
1265 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
1266 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
1267 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
1268 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
1269 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
1270 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
1271 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
1272 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
1273 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1274 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.28
Metatranscriptomes 14.13
Isolates 9.59

Biome Distribution

Category Percentage (%)
Aerial Root 0.07
Bulb 0
Endosphere 10.81
Nodule 0.82
Rhizoplane 5.11
Rhizosphere 73.59
Stem 0
Stem Tuber 0
Unclassified 9.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_30 2124908027 Bacteria 50483
2 SwRhRL2b_contig_1172913 2162886007 Bacteria 1290
3 SwRhRL2b_contig_1776613 2162886007 Bacteria 1025
4 2214905765 2209111006 Bacteria 556
5 ARcpr5yngRDRAFT_c016669 3300000043 Bacteria 616
6 JGI24736J21556_1000834 3300001904 Bacteria 5687
7 JGI24736J21556_1009926 3300001904 Bacteria 1562
8 JGI24736J21556_1015964 3300001904 Bacteria 1199
9 JGI24736J21556_1018996 3300001904 Bacteria 1086
10 JGI24736J21556_1019775 3300001904 Bacteria 1062
11 JGI24741J21665_1004452 3300001915 Bacteria 3102
12 JGI24741J21665_1006431 3300001915 Bacteria 2360
13 JGI24741J21665_1010023 3300001915 Bacteria 1715
14 JGI24741J21665_1018609 3300001915 Bacteria 1109
15 JGI24741J21665_1040660 3300001915 Bacteria 686
16 JGI24746J21847_1019566 3300001977 Bacteria 953
17 JGI24740J21852_10001224 3300001979 Bacteria 11607
18 JGI24740J21852_10003737 3300001979 Bacteria 6625
19 JGI24740J21852_10006264 3300001979 Bacteria 4944
20 JGI24740J21852_10007528 3300001979 Bacteria 4416
21 JGI24740J21852_10012232 3300001979 Bacteria 3240
22 JGI24740J21852_10033981 3300001979 Bacteria 1611
23 JGI24740J21852_10078599 3300001979 Bacteria 868
24 JGI24740J21852_10146508 3300001979 Bacteria 587
25 JGI24739J22299_10000118 3300001989 Bacteria 24899
26 JGI24739J22299_10006773 3300001989 Bacteria 4313
27 JGI24739J22299_10062669 3300001989 Bacteria 1172
28 JGI24739J22299_10099229 3300001989 Bacteria 880
29 JGI24737J22298_10000685 3300001990 Bacteria 11898
30 JGI24737J22298_10010174 3300001990 Bacteria 3112
31 JGI24737J22298_10010685 3300001990 Bacteria 3024
32 JGI24737J22298_10016732 3300001990 Bacteria 2367
33 JGI24737J22298_10029906 3300001990 Bacteria 1706
34 JGI24737J22298_10092281 3300001990 Bacteria 898
35 JGI24735J21928_10009574 3300002067 Bacteria 3107
36 JGI24735J21928_10011190 3300002067 Bacteria 2848
37 JGI24735J21928_10015249 3300002067 Bacteria 2399
38 JGI24735J21928_10016331 3300002067 Bacteria 2306
39 JGI24735J21928_10159064 3300002067 Bacteria 652
40 JGI24748J21848_1024607 3300002074 Bacteria 733
41 JGI24738J21930_10000244 3300002075 Bacteria 14787
42 JGI24738J21930_10015057 3300002075 Bacteria 1650
43 JGI25155J39150_1000031 3300002704 Bacteria 106418
44 JGI25156J39149_1000040 3300002705 Bacteria 106617
45 JGI25156J39149_1002085 3300002705 Bacteria 7577
46 JGI25156J39149_1002290 3300002705 Bacteria 7025
47 JGI25156J39149_1022805 3300002705 Bacteria 1056
48 JGI25156J39149_1031613 3300002705 Bacteria 787
49 JGI25162J39368_1003847 3300002737 Bacteria 3938
50 JGI25162J39368_1003864 3300002737 Bacteria 3912
51 JGI25162J39368_1003895 3300002737 Bacteria 3875
52 JGI25162J39368_1009073 3300002737 Bacteria 1361
53 JGI25162J39368_1012641 3300002737 Bacteria 963
54 JGI25154J39366_1000060 3300002738 Bacteria 106617
55 JGI25154J39366_1002089 3300002738 Bacteria 5649
56 JGI25154J39366_1008638 3300002738 Bacteria 1301
57 JGI25154J39366_1012839 3300002738 Bacteria 913
58 JGI25154J39366_1017829 3300002738 Bacteria 703
59 JGI25158J39367_1015001 3300002739 Bacteria 996
60 JGI25158J39367_1023694 3300002739 Bacteria 732
61 JGI25157J39369_1000058 3300002741 Bacteria 106617
62 JGI25157J39369_1001153 3300002741 Bacteria 11428
63 JGI25157J39369_1001750 3300002741 Bacteria 7146
64 JGI25157J39369_1001921 3300002741 Bacteria 6268
65 JGI25157J39369_1002043 3300002741 Bacteria 5780
66 JGI25157J39369_1002044 3300002741 Bacteria 5780
67 JGI25157J39369_1022941 3300002741 Bacteria 735
68 JGI25163J39215_1001413 3300002771 Bacteria 4010
69 JGI25163J39215_1001875 3300002771 Bacteria 2736
70 JGI25164J39214_1000312 3300002772 Bacteria 31934
71 JGI25164J39214_1000781 3300002772 Bacteria 11524
72 JGI25164J39214_1004872 3300002772 Bacteria 1504
73 JGI25152J39213_1000284 3300002773 Bacteria 33794
74 JGI25152J39213_1010210 3300002773 Bacteria 2167
75 JGI25152J39213_1018186 3300002773 Bacteria 1305
76 JGI25152J39213_1022406 3300002773 Bacteria 1093
77 JGI25152J39213_1037569 3300002773 Bacteria 701
78 JGI25150J39212_1000359 3300002774 Bacteria 22362
79 JGI25150J39212_1013182 3300002774 Bacteria 1439
80 JGI25150J39212_1033873 3300002774 Bacteria 691
81 Ga0006761J43178_114168 3300002865 Bacteria 532
82 JGI25159J45721_1006612 3300002987 Bacteria 3445
83 JGI25159J45721_1024889 3300002987 Bacteria 1057
84 JGI25159J45721_1032032 3300002987 Bacteria 835
85 Ga0006759J45824_1029280 3300003163 Bacteria 590
86 Ga0006759J45824_1069561 3300003163 Bacteria 1494
87 JGI25151J46595_10000895 3300003187 Bacteria 23452
88 JGI25151J46595_10007643 3300003187 Bacteria 5275
89 JGI25151J46595_10007660 3300003187 Bacteria 5267
90 JGI25151J46595_10034563 3300003187 Bacteria 1931
91 JGI25151J46595_10036692 3300003187 Bacteria 1846
92 JGI25406J46586_10169214 3300003203 Bacteria 637
93 JGI25165J46597_1000586 3300003214 Bacteria 31905
94 JGI25165J46597_1001532 3300003214 Bacteria 11524
95 JGI25165J46597_1009174 3300003214 Bacteria 1504
96 JGI25153J46596_10000050 3300003215 Bacteria 140710
97 JGI25153J46596_10019972 3300003215 Bacteria 2547
98 JGI25153J46596_10058987 3300003215 Bacteria 1053
99 JGI25153J46596_10062262 3300003215 Bacteria 1007
100 JGI25153J46596_10115215 3300003215 Bacteria 612
101 Ga0006758J48902_1014812 3300003300 Bacteria 678
102 Ga0006758J48902_1015573 3300003300 Bacteria 1127
103 Ga0006770J48903_1007534 3300003305 Bacteria 6179
104 Ga0006777J48905_1024353 3300003308 Bacteria 1819
105 rootH1_10017276 3300003323 Bacteria 33770
106 rootH1_10017878 3300003323 Bacteria 1767
107 rootH1_10060094 3300003323 Bacteria 5417
108 JGI25160J50197_1006136 3300003354 Bacteria 4900
109 JGI25160J50197_1087302 3300003354 Bacteria 570
110 JGI26145J50221_1000107 3300003371 Bacteria 6560
111 JGI25161J50226_1000021 3300003374 Bacteria 163584
112 JGI25161J50226_1013861 3300003374 Bacteria 920
113 JGI26139J50223_100830 3300003382 Bacteria 972
114 JGI26139J50223_101177 3300003382 Bacteria 800
115 JGI26140J50224_103888 3300003383 Bacteria 559
116 JGI26134J50242_103769 3300003392 Bacteria 523
117 JGI26131J50246_103152 3300003400 Bacteria 542
118 JGI26132J50249_101728 3300003405 Bacteria 748
119 Ga0006556J51387_1018520 3300003479 Bacteria 14040
120 Ga0006556J51387_1029536 3300003479 Bacteria 4901
121 JGI26143J51219_1000464 3300003502 Bacteria 1598
122 JGI26141J51220_1002450 3300003503 Bacteria 1135
123 JGI26138J51218_100502 3300003504 Bacteria 1539
124 JGI26138J51218_104514 3300003504 Bacteria 617
125 Ga0007417J51691_1021462 3300003544 Bacteria 1399
126 Ga0006558J51389_1018313 3300003558 Bacteria 6898
127 Ga0006558J51389_1029818 3300003558 Bacteria 867
128 Ga0007427J51700_102388 3300003559 Bacteria 3100
129 Ga0007427J51700_117842 3300003559 Bacteria 682
130 Ga0006560J51390_1017170 3300003565 Bacteria 14049
131 Ga0006560J51390_1022861 3300003565 Bacteria 1344
132 Ga0006554J51385_1017088 3300003567 Bacteria 14046
133 Ga0006554J51385_1020490 3300003567 Bacteria 10124
134 Ga0006781J51513_1037588 3300003568 Bacteria 580
135 Ga0007410J51695_1018423 3300003574 Bacteria 577
136 Ga0007410J51695_1018957 3300003574 Bacteria 1185
137 Ga0007410J51695_1019754 3300003574 Bacteria 6630
138 Ga0007410J51695_1063545 3300003574 Bacteria 612
139 Ga0007410J51695_1074802 3300003574 Bacteria 574
140 Ga0007409J51694_1018377 3300003575 Bacteria 4021
141 Ga0007409J51694_1052656 3300003575 Bacteria 4258
142 Ga0007409J51694_1057489 3300003575 Bacteria 545
143 Ga0007416J51690_1019168 3300003577 Bacteria 773
144 Ga0007416J51690_1029297 3300003577 Bacteria 1740
145 Ga0007416J51690_1048204 3300003577 Bacteria 821
146 Ga0007416J51690_1075250 3300003577 Bacteria 873
147 Ga0006562J51391_1006869 3300003578 Bacteria 31335
148 Ga0006562J51391_1018587 3300003578 Bacteria 6552
149 Ga0006562J51391_1032739 3300003578 Bacteria 1500
150 Ga0007429J51699_1042349 3300003579 Bacteria 961
151 Ga0007429J51699_1052955 3300003579 Bacteria 525
152 Ga0007429J51699_1058662 3300003579 Bacteria 764
153 Ga0007429J51699_1059725 3300003579 Bacteria 737
154 Ga0032354_1037710 3300003693 Bacteria 3259
155 Ga0032354_1041331 3300003693 Bacteria 1772
156 Ga0032354_1059945 3300003693 Bacteria 598
157 Ga0032354_1093160 3300003693 Bacteria 792
158 Ga0006780_1028552 3300003735 Bacteria 1164
159 Ga0006780_1029635 3300003735 Bacteria 957
160 Ga0055538_1000042 3300003751 Bacteria 164754
161 Ga0055538_1000680 3300003751 Bacteria 10513
162 Ga0055539_1000055 3300003752 Bacteria 164754
163 Ga0055539_1000456 3300003752 Bacteria 13948
164 Ga0055533_1000067 3300003756 Bacteria 164754
165 Ga0055533_1000432 3300003756 Bacteria 15970
166 Ga0055533_1002319 3300003756 Bacteria 4392
167 Ga0055533_1006853 3300003756 Bacteria 1622
168 Ga0055532_1000053 3300003758 Bacteria 164751
169 Ga0055525_1000111 3300003759 Bacteria 127836
170 Ga0055527_1001178 3300003760 Bacteria 5917
171 Ga0055527_1001334 3300003760 Bacteria 5331
172 Ga0055527_1008251 3300003760 Bacteria 1248
173 Ga0055527_1012562 3300003760 Bacteria 955
174 Ga0055535_1000833 3300003761 Bacteria 22124
175 Ga0055535_1002233 3300003761 Bacteria 7272
176 Ga0055535_1002650 3300003761 Bacteria 5917
177 Ga0055535_1002929 3300003761 Bacteria 5298
178 Ga0055535_1004862 3300003761 Bacteria 3121
179 Ga0055535_1006090 3300003761 Bacteria 2508
180 Ga0055535_1006166 3300003761 Bacteria 2478
181 Ga0055542_1000811 3300003762 Bacteria 22966
182 Ga0055542_1002512 3300003762 Bacteria 5917
183 Ga0055542_1003780 3300003762 Bacteria 3938
184 Ga0055542_1003848 3300003762 Bacteria 3875
185 Ga0055542_1003932 3300003762 Bacteria 3807
186 Ga0055542_1004903 3300003762 Bacteria 3121
187 Ga0055542_1006542 3300003762 Bacteria 2478
188 Ga0055529_1001670 3300003763 Bacteria 5780
189 Ga0055529_1002611 3300003763 Bacteria 3349
190 Ga0055529_1010809 3300003763 Bacteria 1182
191 Ga0055529_1024724 3300003763 Bacteria 743
192 Ga0055526_1005867 3300003771 Bacteria 6888
193 Ga0055526_1008536 3300003771 Bacteria 5088
194 Ga0055526_1008987 3300003771 Bacteria 4886
195 Ga0055526_1061500 3300003771 Bacteria 799
196 Ga0055526_1096816 3300003771 Bacteria 547
197 Ga0055526_1096935 3300003771 Bacteria 547
198 Ga0055537_1000851 3300003773 Bacteria 14843
199 Ga0055537_1001096 3300003773 Bacteria 11761
200 Ga0055537_1021185 3300003773 Bacteria 972
201 Ga0055537_1024756 3300003773 Bacteria 839
202 Ga0055537_1028635 3300003773 Bacteria 737
203 Ga0055537_1029032 3300003773 Bacteria 728
204 Ga0055524_1000338 3300003775 Bacteria 43287
205 Ga0055524_1002940 3300003775 Bacteria 8496
206 Ga0055524_1003518 3300003775 Bacteria 7575
207 Ga0055524_1027470 3300003775 Bacteria 1725
208 Ga0055524_1084035 3300003775 Bacteria 570
209 Ga0055536_1012444 3300003781 Bacteria 3157
210 Ga0055536_1020462 3300003781 Bacteria 2042
211 Ga0055536_1021046 3300003781 Bacteria 1993
212 Ga0055536_1065689 3300003781 Bacteria 734
213 Ga0055536_1086074 3300003781 Bacteria 587
214 Ga0055534_1000766 3300003784 Bacteria 15218
215 Ga0055534_1003331 3300003784 Bacteria 5088
216 Ga0055534_1009637 3300003784 Bacteria 2083
217 Ga0055534_1010410 3300003784 Bacteria 1950
218 Ga0055534_1010567 3300003784 Bacteria 1926
219 Ga0055534_1024681 3300003784 Bacteria 972
220 Ga0055534_1036544 3300003784 Bacteria 737
221 Ga0055534_1036622 3300003784 Bacteria 737
222 Ga0055528_1001693 3300003790 Bacteria 12842
223 Ga0055528_1001961 3300003790 Bacteria 11621
224 Ga0055528_1020733 3300003790 Bacteria 2119
225 Ga0055528_1024938 3300003790 Bacteria 1775
226 Ga0055528_1029995 3300003790 Bacteria 1456
227 Ga0055530_10004966 3300003791 Bacteria 6579
228 Ga0055530_10009756 3300003791 Bacteria 3638
229 Ga0055530_10013347 3300003791 Bacteria 2809
230 Ga0055530_10024936 3300003791 Bacteria 1681
231 Ga0055530_10029773 3300003791 Bacteria 1455
232 Ga0055540_1000274 3300003792 Bacteria 46571
233 Ga0055540_1006952 3300003792 Bacteria 4374
234 Ga0055540_1015562 3300003792 Bacteria 2205
235 Ga0055540_1022881 3300003792 Bacteria 1587
236 Ga0055540_1080191 3300003792 Bacteria 626
237 Ga0055531_10003374 3300003794 Bacteria 10210
238 Ga0055531_10014020 3300003794 Bacteria 3645
239 Ga0055531_10025809 3300003794 Bacteria 2118
240 Ga0055531_10027931 3300003794 Bacteria 1961
241 Ga0055531_10034155 3300003794 Bacteria 1620
242 Ga0055531_10081564 3300003794 Bacteria 711
243 Ga0055531_10088353 3300003794 Bacteria 664
244 Ga0055541_1000042 3300003841 Bacteria 164754
245 Ga0058692_1000748 3300003856 Bacteria 13063
246 Ga0058692_1000785 3300003856 Bacteria 12735
247 Ga0058692_1010052 3300003856 Bacteria 2355
248 Ga0058692_1022959 3300003856 Bacteria 1275
249 Ga0058692_1028438 3300003856 Bacteria 1078
250 Ga0055543_1000238 3300004625 Bacteria 42822
251 Ga0058858_1003843 3300004785 Bacteria 870
252 Ga0058858_1016017 3300004785 Bacteria 1537
253 Ga0058858_1021436 3300004785 Bacteria 2322
254 Ga0058858_1422938 3300004785 Bacteria 1495
255 Ga0058859_11780553 3300004798 Bacteria 1128
256 Ga0058859_11828919 3300004798 Bacteria 808
257 Ga0058863_10015881 3300004799 Bacteria 2282
258 Ga0058863_11705057 3300004799 Bacteria 713
259 Ga0058861_11948199 3300004800 Bacteria 882
260 Ga0058861_11994669 3300004800 Bacteria 654
261 Ga0058861_12043031 3300004800 Bacteria 692
262 Ga0058861_12044230 3300004800 Bacteria 1239
263 Ga0058860_10012449 3300004801 Bacteria 620
264 Ga0058860_10027358 3300004801 Bacteria 683
265 Ga0058860_10042416 3300004801 Bacteria 2731
266 Ga0058860_10056819 3300004801 Bacteria 1761
267 Ga0058860_10099424 3300004801 Bacteria 1270
268 Ga0058860_10137024 3300004801 Bacteria 3744
269 Ga0058860_10224633 3300004801 Bacteria 697
270 Ga0058862_10010531 3300004803 Bacteria 938
271 Ga0058862_12536277 3300004803 Bacteria 736
272 Ga0058862_12785357 3300004803 Bacteria 650
273 Ga0065165_1000598 3300005262 Bacteria 52772
274 Ga0065165_1018680 3300005262 Bacteria 2502
275 Ga0065165_1026628 3300005262 Bacteria 1899
276 Ga0065165_1039064 3300005262 Bacteria 1424
277 Ga0065716_1007133 3300005277 Bacteria 770
278 Ga0065716_1013521 3300005277 Bacteria 588
279 Ga0065714_10000007 3300005288 Bacteria 22418
280 Ga0065714_10008398 3300005288 Bacteria 3992
281 Ga0065714_10012529 3300005288 Bacteria 1787
282 Ga0065714_10012673 3300005288 Bacteria 1936
283 Ga0065714_10028497 3300005288 Bacteria 1701
284 Ga0065714_10148435 3300005288 Bacteria 1114
285 Ga0065714_10358246 3300005288 Bacteria 625
286 Ga0065714_10358924 3300005288 Bacteria 614
287 Ga0065714_10408433 3300005288 Bacteria 574
288 Ga0065704_10020815 3300005289 Bacteria 1385
289 Ga0065704_10025805 3300005289 Bacteria 1727
290 Ga0065704_10071563 3300005289 Bacteria 10695
291 Ga0065704_10118559 3300005289 Bacteria 1814
292 Ga0065704_10141096 3300005289 Bacteria 1517
293 Ga0065704_10145820 3300005289 Bacteria 1416
294 Ga0065704_10188262 3300005289 Bacteria 1202
295 Ga0065704_10217134 3300005289 Bacteria 1087
296 Ga0065704_10630414 3300005289 Bacteria 583
297 Ga0065704_10643093 3300005289 Bacteria 585
298 Ga0065712_10034257 3300005290 Bacteria 803
299 Ga0065712_10053095 3300005290 Bacteria 575
300 Ga0065712_10708596 3300005290 Bacteria 544
301 Ga0065712_10840486 3300005290 Bacteria 500
302 Ga0065715_10009176 3300005293 Bacteria 2370
303 Ga0065715_10035747 3300005293 Bacteria 1369
304 Ga0065715_10077491 3300005293 Bacteria 654
305 Ga0065715_10291245 3300005293 Bacteria 1060
306 Ga0065715_10476019 3300005293 Bacteria 800
307 Ga0065715_10827400 3300005293 Bacteria 600
308 Ga0065715_11111098 3300005293 Bacteria 517
309 Ga0065715_11117656 3300005293 Bacteria 511
310 Ga0070658_10080946 3300005327 Bacteria 2668
311 Ga0070658_10259540 3300005327 Bacteria 1475
312 Ga0070658_10367216 3300005327 Bacteria 1233
313 Ga0070658_10600713 3300005327 Bacteria 954
314 Ga0070658_10966965 3300005327 Bacteria 740
315 Ga0070658_11402470 3300005327 Bacteria 606
316 Ga0070658_11431930 3300005327 Bacteria 599
317 Ga0070658_11519369 3300005327 Bacteria 581
318 Ga0070676_10105815 3300005328 Bacteria 1745
319 Ga0070676_10152962 3300005328 Bacteria 1478
320 Ga0070683_100111715 3300005329 Bacteria 2578
321 Ga0070683_100579184 3300005329 Bacteria 1074
322 Ga0070683_100748167 3300005329 Bacteria 936
323 Ga0070683_101560370 3300005329 Bacteria 635
324 Ga0070683_101644216 3300005329 Bacteria 617
325 Ga0070683_102155092 3300005329 Bacteria 535
326 Ga0070690_100205964 3300005330 Bacteria 1371
327 Ga0070690_100385444 3300005330 Bacteria 1026
328 Ga0070690_100461122 3300005330 Bacteria 944
329 Ga0070670_100015496 3300005331 Bacteria 6547
330 Ga0070670_100127224 3300005331 Bacteria 2199
331 Ga0070670_100303660 3300005331 Bacteria 1396
332 Ga0070670_100398642 3300005331 Bacteria 1215
333 Ga0070670_100505876 3300005331 Bacteria 1075
334 Ga0070670_100575042 3300005331 Bacteria 1007
335 Ga0070670_100974355 3300005331 Bacteria 770
336 Ga0070670_101455527 3300005331 Bacteria 628
337 Ga0070677_10051748 3300005333 Bacteria 1664
338 Ga0070677_10301205 3300005333 Bacteria 815
339 Ga0070677_10353843 3300005333 Bacteria 762
340 Ga0068869_100131341 3300005334 Bacteria 1925
341 Ga0068869_100194973 3300005334 Bacteria 1595
342 Ga0068869_100319169 3300005334 Bacteria 1259
343 Ga0068869_100978594 3300005334 Bacteria 736
344 Ga0068869_101215861 3300005334 Bacteria 662
345 Ga0070666_10000012 3300005335 Bacteria 244720
346 Ga0070666_10312836 3300005335 Bacteria 1119
347 Ga0070666_10343832 3300005335 Bacteria 1066
348 Ga0070666_11082769 3300005335 Bacteria 596
349 Ga0070680_100176719 3300005336 Bacteria 1797
350 Ga0070680_100194325 3300005336 Bacteria 1710
351 Ga0070680_100219574 3300005336 Bacteria 1604
352 Ga0070680_100226132 3300005336 Bacteria 1580
353 Ga0070680_100245821 3300005336 Bacteria 1512
354 Ga0070680_100313899 3300005336 Bacteria 1330
355 Ga0070680_100435181 3300005336 Bacteria 1120
356 Ga0070680_100492363 3300005336 Bacteria 1049
357 Ga0070680_100631886 3300005336 Bacteria 920
358 Ga0070680_100884344 3300005336 Bacteria 770
359 Ga0070682_100005710 3300005337 Bacteria 6936
360 Ga0070682_100050614 3300005337 Bacteria 2594
361 Ga0070682_100099706 3300005337 Bacteria 1915
362 Ga0070682_100148284 3300005337 Bacteria 1607
363 Ga0070682_100963432 3300005337 Bacteria 705
364 Ga0070682_101117769 3300005337 Bacteria 661
365 Ga0070682_101264338 3300005337 Bacteria 625
366 Ga0068868_100033369 3300005338 Bacteria 3967
367 Ga0068868_100671308 3300005338 Bacteria 924
368 Ga0068868_100887173 3300005338 Bacteria 810
369 Ga0070660_100058257 3300005339 Bacteria 2994
370 Ga0070660_100196258 3300005339 Bacteria 1636
371 Ga0070660_100214434 3300005339 Bacteria 1563
372 Ga0070660_100296754 3300005339 Bacteria 1324
373 Ga0070660_100431541 3300005339 Bacteria 1092
374 Ga0070660_100527256 3300005339 Bacteria 984
375 Ga0070660_100563269 3300005339 Bacteria 951
376 Ga0070660_101781207 3300005339 Bacteria 525
377 Ga0070689_100013126 3300005340 Bacteria 5987
378 Ga0070689_100050593 3300005340 Bacteria 3211
379 Ga0070691_10082368 3300005341 Bacteria 1577
380 Ga0070691_10124922 3300005341 Bacteria 1298
381 Ga0070691_10220115 3300005341 Bacteria 1006
382 Ga0070687_100319995 3300005343 Bacteria 991
383 Ga0070661_100005189 3300005344 Bacteria 8965
384 Ga0070661_100015281 3300005344 Bacteria 5418
385 Ga0070661_100025376 3300005344 Bacteria 4259
386 Ga0070661_100025415 3300005344 Bacteria 4255
387 Ga0070661_100028282 3300005344 Bacteria 4043
388 Ga0070661_100060170 3300005344 Bacteria 2787
389 Ga0070661_100063908 3300005344 Bacteria 2704
390 Ga0070661_100240662 3300005344 Bacteria 1393
391 Ga0070661_100268996 3300005344 Bacteria 1319
392 Ga0070661_100501530 3300005344 Bacteria 971
393 Ga0070661_100511161 3300005344 Bacteria 962
394 Ga0070661_100563964 3300005344 Bacteria 917
395 Ga0070661_100620413 3300005344 Bacteria 876
396 Ga0070661_101483417 3300005344 Bacteria 572
397 Ga0070692_10007700 3300005345 Bacteria 4763
398 Ga0070692_10033906 3300005345 Bacteria 2575
399 Ga0070692_10043999 3300005345 Bacteria 2298
400 Ga0070692_10177043 3300005345 Bacteria 1233
401 Ga0070668_100106043 3300005347 Bacteria 2232
402 Ga0070668_100131613 3300005347 Bacteria 2008
403 Ga0070668_100152536 3300005347 Bacteria 1869
404 Ga0070668_100160966 3300005347 Bacteria 1821
405 Ga0070668_100292158 3300005347 Bacteria 1364
406 Ga0070668_100329946 3300005347 Bacteria 1286
407 Ga0070668_100342193 3300005347 Bacteria 1264
408 Ga0070668_102059175 3300005347 Bacteria 527
409 Ga0070669_100004975 3300005353 Bacteria 9603
410 Ga0070669_100049915 3300005353 Bacteria 3055
411 Ga0070669_100192029 3300005353 Bacteria 1602
412 Ga0070669_100267140 3300005353 Bacteria 1367
413 Ga0070669_100419198 3300005353 Bacteria 1098
414 Ga0070669_100698189 3300005353 Bacteria 857
415 Ga0070669_101181107 3300005353 Bacteria 661
416 Ga0070669_101264327 3300005353 Bacteria 638
417 Ga0070675_100105895 3300005354 Bacteria 2373
418 Ga0070675_100154524 3300005354 Bacteria 1969
419 Ga0070675_100541104 3300005354 Bacteria 1052
420 Ga0070675_100851346 3300005354 Bacteria 834
421 Ga0070675_100952268 3300005354 Bacteria 788
422 Ga0070675_101908030 3300005354 Bacteria 548
423 Ga0070671_100012931 3300005355 Bacteria 6725
424 Ga0070671_100183827 3300005355 Bacteria 1770
425 Ga0070671_100627745 3300005355 Bacteria 929
426 Ga0070671_101112665 3300005355 Bacteria 694
427 Ga0070671_101357139 3300005355 Bacteria 628
428 Ga0070671_101605198 3300005355 Bacteria 576
429 Ga0070671_101903479 3300005355 Bacteria 529
430 Ga0070674_100092385 3300005356 Bacteria 2187
431 Ga0070674_100103259 3300005356 Bacteria 2081
432 Ga0070674_100261513 3300005356 Bacteria 1363
433 Ga0070674_100938877 3300005356 Bacteria 756
434 Ga0070674_101449567 3300005356 Bacteria 616
435 Ga0070673_100046662 3300005364 Bacteria 3366
436 Ga0070673_100413930 3300005364 Bacteria 1207
437 Ga0070673_100491725 3300005364 Bacteria 1109
438 Ga0070673_101105209 3300005364 Bacteria 741
439 Ga0070673_101482337 3300005364 Bacteria 639
440 Ga0070673_102040142 3300005364 Bacteria 545
441 Ga0070688_100115758 3300005365 Bacteria 1789
442 Ga0070688_100158691 3300005365 Bacteria 1553
443 Ga0070688_100175493 3300005365 Bacteria 1482
444 Ga0070688_100895485 3300005365 Bacteria 699
445 Ga0070659_100082555 3300005366 Bacteria 2567
446 Ga0070659_100087709 3300005366 Bacteria 2491
447 Ga0070659_100118562 3300005366 Bacteria 2141
448 Ga0070659_100342152 3300005366 Bacteria 1253
449 Ga0070659_100843307 3300005366 Bacteria 798
450 Ga0070659_100889984 3300005366 Bacteria 778
451 Ga0070659_101413658 3300005366 Bacteria 619
452 Ga0070667_100030004 3300005367 Bacteria 4535
453 Ga0070667_100062633 3300005367 Bacteria 3151
454 Ga0070667_100092898 3300005367 Bacteria 2597
455 Ga0070667_100123563 3300005367 Bacteria 2253
456 Ga0070667_100135527 3300005367 Bacteria 2152
457 Ga0070667_100220389 3300005367 Bacteria 1688
458 Ga0070667_100889603 3300005367 Bacteria 829
459 Ga0070667_100937059 3300005367 Bacteria 807
460 Ga0070667_102165261 3300005367 Bacteria 524
461 Ga0070714_100086583 3300005435 Bacteria 2738
462 Ga0070714_101165314 3300005435 Bacteria 752
463 Ga0070713_100008401 3300005436 Bacteria 7319
464 Ga0070713_100295588 3300005436 Bacteria 1490
465 Ga0070710_10139871 3300005437 Bacteria 1483
466 Ga0070701_10090109 3300005438 Bacteria 1679
467 Ga0070701_10805723 3300005438 Bacteria 641
468 Ga0070711_100176889 3300005439 Bacteria 1631
469 Ga0070705_100787798 3300005440 Bacteria 755
470 Ga0070700_100411194 3300005441 Bacteria 1020
471 Ga0070700_100646238 3300005441 Bacteria 835
472 Ga0070700_101078180 3300005441 Bacteria 665
473 Ga0070694_101362711 3300005444 Bacteria 598
474 Ga0070708_100882660 3300005445 Bacteria 840
475 Ga0070663_100005120 3300005455 Bacteria 7762
476 Ga0070663_100024491 3300005455 Bacteria 4064
477 Ga0070663_100036003 3300005455 Bacteria 3438
478 Ga0070663_100036599 3300005455 Bacteria 3410
479 Ga0070663_100053898 3300005455 Bacteria 2873
480 Ga0070663_100059429 3300005455 Bacteria 2747
481 Ga0070663_100070482 3300005455 Bacteria 2542
482 Ga0070663_100073683 3300005455 Bacteria 2491
483 Ga0070663_100079408 3300005455 Bacteria 2407
484 Ga0070663_100120095 3300005455 Bacteria 1984
485 Ga0070663_100440482 3300005455 Bacteria 1072
486 Ga0070663_100481614 3300005455 Bacteria 1027
487 Ga0070663_100496719 3300005455 Bacteria 1012
488 Ga0070663_100678757 3300005455 Bacteria 874
489 Ga0070663_100734984 3300005455 Bacteria 841
490 Ga0070663_102105856 3300005455 Bacteria 508
491 Ga0070678_100112773 3300005456 Bacteria 2130
492 Ga0070678_100145207 3300005456 Bacteria 1904
493 Ga0070678_100154201 3300005456 Bacteria 1854
494 Ga0070678_100204118 3300005456 Bacteria 1633
495 Ga0070678_100362980 3300005456 Bacteria 1248
496 Ga0070678_100413100 3300005456 Bacteria 1175
497 Ga0070678_100456016 3300005456 Bacteria 1120
498 Ga0070662_100045686 3300005457 Bacteria 3144
499 Ga0070662_100148173 3300005457 Bacteria 1824
500 Ga0070662_100243398 3300005457 Bacteria 1443
501 Ga0070662_100378057 3300005457 Bacteria 1165
502 Ga0070662_100404195 3300005457 Bacteria 1127
503 Ga0070662_100504078 3300005457 Bacteria 1010
504 Ga0070662_100864428 3300005457 Bacteria 770
505 Ga0070662_100950323 3300005457 Bacteria 735
506 Ga0070662_101313803 3300005457 Bacteria 622
507 Ga0070681_10000250 3300005458 Bacteria 42625
508 Ga0070681_10072551 3300005458 Bacteria 3405
509 Ga0070681_10075723 3300005458 Bacteria 3325
510 Ga0070681_10245444 3300005458 Bacteria 1704
511 Ga0070681_10247300 3300005458 Bacteria 1696
512 Ga0070681_10319454 3300005458 Bacteria 1462
513 Ga0070681_10555001 3300005458 Bacteria 1062
514 Ga0070681_10784766 3300005458 Bacteria 869
515 Ga0070681_11141223 3300005458 Bacteria 701
516 Ga0070681_11558922 3300005458 Bacteria 586
517 Ga0068867_100047984 3300005459 Bacteria 3140
518 Ga0068867_100121217 3300005459 Bacteria 2021
519 Ga0068867_101174500 3300005459 Bacteria 704
520 Ga0068867_101392403 3300005459 Bacteria 650
521 Ga0070685_10002255 3300005466 Bacteria 9947
522 Ga0070685_10602475 3300005466 Bacteria 791
523 Ga0070685_10743457 3300005466 Bacteria 718
524 Ga0070706_100225104 3300005467 Bacteria 1751
525 Ga0070706_100319949 3300005467 Bacteria 1447
526 Ga0070707_100083981 3300005468 Bacteria 3077
527 Ga0070699_101195153 3300005518 Bacteria 698
528 Ga0070679_100078448 3300005530 Bacteria 3291
529 Ga0070679_100149442 3300005530 Bacteria 2313
530 Ga0070679_100193566 3300005530 Bacteria 2001
531 Ga0070679_100235593 3300005530 Bacteria 1789
532 Ga0070679_100258581 3300005530 Bacteria 1696
533 Ga0070679_100657230 3300005530 Bacteria 991
534 Ga0070679_101051480 3300005530 Bacteria 758
535 Ga0070679_101254332 3300005530 Bacteria 687
536 Ga0070679_101408186 3300005530 Bacteria 643
537 Ga0070684_100046485 3300005535 Bacteria 3761
538 Ga0070684_100592471 3300005535 Bacteria 1030
539 Ga0070684_102348363 3300005535 Bacteria 503
540 Ga0068853_100001115 3300005539 Bacteria 19015
541 Ga0068853_100010321 3300005539 Bacteria 7553
542 Ga0068853_100023635 3300005539 Bacteria 5148
543 Ga0068853_100029334 3300005539 Bacteria 4636
544 Ga0068853_100035785 3300005539 Bacteria 4219
545 Ga0068853_100046419 3300005539 Bacteria 3724
546 Ga0068853_100126368 3300005539 Bacteria 2284
547 Ga0068853_100248836 3300005539 Bacteria 1630
548 Ga0068853_100291016 3300005539 Bacteria 1508
549 Ga0068853_100298127 3300005539 Bacteria 1489
550 Ga0068853_100325099 3300005539 Bacteria 1426
551 Ga0068853_100399949 3300005539 Bacteria 1285
552 Ga0068853_100413685 3300005539 Bacteria 1264
553 Ga0068853_100434858 3300005539 Bacteria 1232
554 Ga0068853_100438748 3300005539 Bacteria 1227
555 Ga0068853_100443992 3300005539 Bacteria 1219
556 Ga0068853_102357326 3300005539 Bacteria 515
557 Ga0070672_100087779 3300005543 Bacteria 2503
558 Ga0070672_100212901 3300005543 Bacteria 1619
559 Ga0070672_100225826 3300005543 Bacteria 1572
560 Ga0070672_101302427 3300005543 Bacteria 649
561 Ga0070672_101619507 3300005543 Bacteria 581
562 Ga0070686_100881416 3300005544 Bacteria 727
563 Ga0070686_101108696 3300005544 Bacteria 654
564 Ga0070696_100008697 3300005546 Bacteria 6794
565 Ga0070696_100010164 3300005546 Bacteria 6301
566 Ga0070696_100051544 3300005546 Bacteria 2862
567 Ga0070696_100143568 3300005546 Bacteria 1747
568 Ga0070696_100243762 3300005546 Bacteria 1357
569 Ga0070693_100013884 3300005547 Bacteria 4113
570 Ga0070693_100016180 3300005547 Bacteria 3854
571 Ga0070693_100025578 3300005547 Bacteria 3179
572 Ga0070693_100025657 3300005547 Bacteria 3173
573 Ga0070693_100028679 3300005547 Bacteria 3028
574 Ga0070693_100114604 3300005547 Bacteria 1663
575 Ga0070693_100330259 3300005547 Bacteria 1038
576 Ga0070693_100627916 3300005547 Bacteria 779
577 Ga0070665_100004322 3300005548 Bacteria 14941
578 Ga0070665_100009996 3300005548 Bacteria 9599
579 Ga0070665_100016134 3300005548 Bacteria 7496
580 Ga0070665_100114446 3300005548 Bacteria 2700
581 Ga0070665_100123654 3300005548 Bacteria 2589
582 Ga0070665_100300035 3300005548 Bacteria 1609
583 Ga0070665_100659216 3300005548 Bacteria 1060
584 Ga0070665_100746984 3300005548 Bacteria 991
585 Ga0070665_100904094 3300005548 Bacteria 895
586 Ga0070665_101232954 3300005548 Bacteria 758
587 Ga0070665_102256177 3300005548 Bacteria 548
588 Ga0070665_102409324 3300005548 Bacteria 528
589 Ga0070665_102476277 3300005548 Bacteria 521
590 Ga0070704_101791752 3300005549 Bacteria 568
591 Ga0068855_100002511 3300005563 Bacteria 22597
592 Ga0068855_100085311 3300005563 Bacteria 3654
593 Ga0068855_100111964 3300005563 Bacteria 3132
594 Ga0068855_100132917 3300005563 Bacteria 2840
595 Ga0068855_100135916 3300005563 Bacteria 2805
596 Ga0068855_100233589 3300005563 Bacteria 2057
597 Ga0068855_100253283 3300005563 Bacteria 1963
598 Ga0068855_100384533 3300005563 Bacteria 1540
599 Ga0068855_100399501 3300005563 Bacteria 1506
600 Ga0068855_100467381 3300005563 Bacteria 1374
601 Ga0068855_100468040 3300005563 Bacteria 1373
602 Ga0068855_101061271 3300005563 Bacteria 849
603 Ga0068855_101096753 3300005563 Bacteria 832
604 Ga0068855_101892356 3300005563 Bacteria 604
605 Ga0068855_102405748 3300005563 Bacteria 525
606 Ga0068855_102588898 3300005563 Bacteria 503
607 Ga0070664_100094125 3300005564 Bacteria 2598
608 Ga0070664_100186680 3300005564 Bacteria 1845
609 Ga0070664_100200796 3300005564 Bacteria 1779
610 Ga0070664_100349593 3300005564 Bacteria 1344
611 Ga0070664_100883766 3300005564 Bacteria 837
612 Ga0070664_101237792 3300005564 Bacteria 704
613 Ga0070664_101553696 3300005564 Bacteria 626
614 Ga0070664_101907626 3300005564 Bacteria 564
615 Ga0070664_102238629 3300005564 Bacteria 519
616 Ga0070664_102350366 3300005564 Bacteria 506
617 Ga0068857_100000998 3300005577 Bacteria 21742
618 Ga0068857_100088619 3300005577 Bacteria 2768
619 Ga0068857_100113303 3300005577 Bacteria 2438
620 Ga0068857_100195794 3300005577 Bacteria 1841
621 Ga0068857_100302868 3300005577 Bacteria 1474
622 Ga0068857_100356915 3300005577 Bacteria 1354
623 Ga0068857_100474801 3300005577 Bacteria 1171
624 Ga0068857_100803211 3300005577 Bacteria 898
625 Ga0068857_100859228 3300005577 Bacteria 868
626 Ga0068857_100964727 3300005577 Bacteria 819
627 Ga0068857_102075867 3300005577 Bacteria 558
628 Ga0068857_102328025 3300005577 Bacteria 526
629 Ga0068854_100001181 3300005578 Bacteria 15658
630 Ga0068854_100054495 3300005578 Bacteria 2876
631 Ga0068854_100062722 3300005578 Bacteria 2696
632 Ga0068854_100162608 3300005578 Bacteria 1730
633 Ga0068854_100194243 3300005578 Bacteria 1592
634 Ga0068854_100270148 3300005578 Bacteria 1365
635 Ga0068854_100371921 3300005578 Bacteria 1175
636 Ga0068854_100871411 3300005578 Bacteria 789
637 Ga0068854_100984875 3300005578 Bacteria 746
638 Ga0068856_100004797 3300005614 Bacteria 13405
639 Ga0068856_100052710 3300005614 Bacteria 4012
640 Ga0068856_100076451 3300005614 Bacteria 3317
641 Ga0068856_100106606 3300005614 Bacteria 2797
642 Ga0068856_100111271 3300005614 Bacteria 2736
643 Ga0068856_100111931 3300005614 Bacteria 2727
644 Ga0068856_100149200 3300005614 Bacteria 2346
645 Ga0068856_100204651 3300005614 Bacteria 1988
646 Ga0068856_101178948 3300005614 Bacteria 782
647 Ga0068852_100031217 3300005616 Bacteria 4393
648 Ga0068852_100058397 3300005616 Bacteria 3342
649 Ga0068852_100156669 3300005616 Bacteria 2122
650 Ga0068852_100170516 3300005616 Bacteria 2039
651 Ga0068852_100237376 3300005616 Bacteria 1741
652 Ga0068852_100261322 3300005616 Bacteria 1662
653 Ga0068852_100319945 3300005616 Bacteria 1506
654 Ga0068852_100530590 3300005616 Bacteria 1175
655 Ga0068852_100673130 3300005616 Bacteria 1044
656 Ga0068852_100709206 3300005616 Bacteria 1016
657 Ga0068852_100793939 3300005616 Bacteria 960
658 Ga0068852_100879035 3300005616 Bacteria 913
659 Ga0068852_101534194 3300005616 Bacteria 689
660 Ga0068852_102127081 3300005616 Bacteria 583
661 Ga0068859_100448251 3300005617 Bacteria 1387
662 Ga0068859_101149424 3300005617 Bacteria 854
663 Ga0068859_102558224 3300005617 Bacteria 562
664 Ga0068864_100069812 3300005618 Bacteria 3055
665 Ga0068864_100185391 3300005618 Bacteria 1904
666 Ga0068864_100535237 3300005618 Bacteria 1131
667 Ga0068864_101817926 3300005618 Bacteria 615
668 Ga0068861_100118072 3300005719 Bacteria 2136
669 Ga0068861_100623202 3300005719 Bacteria 993
670 Ga0068861_101554380 3300005719 Bacteria 651
671 Ga0068861_101767812 3300005719 Bacteria 613
672 Ga0068851_10000002 3300005834 Bacteria 302756
673 Ga0068851_10014017 3300005834 Bacteria 3800
674 Ga0068851_10026539 3300005834 Bacteria 2848
675 Ga0068851_10027292 3300005834 Bacteria 2813
676 Ga0068851_10069055 3300005834 Bacteria 1825
677 Ga0068851_10074443 3300005834 Bacteria 1763
678 Ga0068851_10175429 3300005834 Bacteria 1185
679 Ga0068851_10704232 3300005834 Bacteria 622
680 Ga0068870_10173464 3300005840 Bacteria 1289
681 Ga0068870_10948038 3300005840 Bacteria 611
682 Ga0068863_100032278 3300005841 Bacteria 4991
683 Ga0068863_100058336 3300005841 Bacteria 3653
684 Ga0068863_100115629 3300005841 Bacteria 2556
685 Ga0068863_100411508 3300005841 Bacteria 1324
686 Ga0068863_100530091 3300005841 Bacteria 1162
687 Ga0068863_100764277 3300005841 Bacteria 963
688 Ga0068863_102529846 3300005841 Bacteria 523
689 Ga0068858_100048710 3300005842 Bacteria 3925
690 Ga0068858_100334092 3300005842 Bacteria 1450
691 Ga0068858_100579150 3300005842 Bacteria 1088
692 Ga0068860_100054090 3300005843 Bacteria 3816
693 Ga0068860_100331590 3300005843 Bacteria 1495
694 Ga0068860_100504897 3300005843 Bacteria 1208
695 Ga0068860_100719396 3300005843 Bacteria 1009
696 Ga0068862_100010918 3300005844 Bacteria 7499
697 Ga0068862_100088990 3300005844 Bacteria 2687
698 Ga0068862_100606903 3300005844 Bacteria 1051
699 Ga0068862_101881665 3300005844 Bacteria 608
700 Ga0068862_102325389 3300005844 Bacteria 548
701 Ga0081455_10053310 3300005937 Bacteria 3455
702 Ga0081539_10024522 3300005985 Bacteria 3909
703 Ga0081539_10289846 3300005985 Bacteria 708
704 Ga0070717_10573168 3300006028 Bacteria 1023
705 Ga0075365_10024324 3300006038 Bacteria 3819
706 Ga0075365_10052184 3300006038 Bacteria 2703
707 Ga0075365_10058118 3300006038 Bacteria 2574
708 Ga0075365_10072215 3300006038 Bacteria 2324
709 Ga0075365_10163444 3300006038 Bacteria 1552
710 Ga0075365_10253119 3300006038 Bacteria 1238
711 Ga0075368_10027366 3300006042 Bacteria 2199
712 Ga0075368_10222799 3300006042 Bacteria 801
713 Ga0075368_10272919 3300006042 Bacteria 726
714 Ga0075368_10289824 3300006042 Bacteria 704
715 Ga0075368_10375626 3300006042 Bacteria 621
716 Ga0075368_10445753 3300006042 Bacteria 573
717 Ga0075368_10467209 3300006042 Bacteria 560
718 Ga0075363_100100355 3300006048 Bacteria 1601
719 Ga0075363_100137748 3300006048 Bacteria 1372
720 Ga0075363_100186638 3300006048 Bacteria 1181
721 Ga0075363_100231239 3300006048 Bacteria 1061
722 Ga0075363_100603747 3300006048 Bacteria 658
723 Ga0075364_10006019 3300006051 Bacteria 7094
724 Ga0075364_10020655 3300006051 Bacteria 4143
725 Ga0075364_10036778 3300006051 Bacteria 3167
726 Ga0075364_10140428 3300006051 Bacteria 1624
727 Ga0075364_10312945 3300006051 Bacteria 1069
728 Ga0075364_10969094 3300006051 Bacteria 578
729 Ga0075432_10012579 3300006058 Bacteria 2875
730 Ga0075432_10068576 3300006058 Bacteria 1271
731 Ga0075432_10087503 3300006058 Bacteria 1137
732 Ga0070715_10175421 3300006163 Bacteria 1071
733 Ga0070715_10440053 3300006163 Bacteria 734
734 Ga0070716_101150851 3300006173 Bacteria 621
735 Ga0070712_100613481 3300006175 Bacteria 922
736 Ga0075362_10276881 3300006177 Bacteria 829
737 Ga0075362_10294513 3300006177 Bacteria 804
738 Ga0075362_10356459 3300006177 Bacteria 733
739 Ga0075362_10645431 3300006177 Bacteria 549
740 Ga0075362_10683527 3300006177 Bacteria 534
741 Ga0075367_10066635 3300006178 Bacteria 2158
742 Ga0075367_10084014 3300006178 Bacteria 1930
743 Ga0075367_10264668 3300006178 Bacteria 1079
744 Ga0075367_10302737 3300006178 Bacteria 1006
745 Ga0075367_10360780 3300006178 Bacteria 917
746 Ga0075367_10905274 3300006178 Bacteria 562
747 Ga0075369_10038431 3300006186 Bacteria 2042
748 Ga0075369_10093292 3300006186 Bacteria 1345
749 Ga0075369_10136829 3300006186 Bacteria 1115
750 Ga0075369_10143950 3300006186 Bacteria 1088
751 Ga0075369_10290472 3300006186 Bacteria 762
752 Ga0075369_10305635 3300006186 Bacteria 743
753 Ga0075369_10382298 3300006186 Bacteria 662
754 Ga0075427_10034804 3300006194 Bacteria 836
755 Ga0075366_10034671 3300006195 Bacteria 2973
756 Ga0075366_10085266 3300006195 Bacteria 1889
757 Ga0075366_10264664 3300006195 Bacteria 1050
758 Ga0075366_10284638 3300006195 Bacteria 1010
759 Ga0075366_10315364 3300006195 Bacteria 957
760 Ga0075366_10418269 3300006195 Bacteria 825
761 Ga0097621_100184626 3300006237 Bacteria 1803
762 Ga0097621_100238448 3300006237 Bacteria 1589
763 Ga0097621_100291714 3300006237 Bacteria 1438
764 Ga0097621_100838472 3300006237 Bacteria 853
765 Ga0097621_101246759 3300006237 Bacteria 701
766 Ga0075370_10058479 3300006353 Bacteria 2193
767 Ga0075370_10078175 3300006353 Bacteria 1899
768 Ga0075370_10140959 3300006353 Bacteria 1409
769 Ga0075370_10144759 3300006353 Bacteria 1390
770 Ga0075370_10153606 3300006353 Bacteria 1349
771 Ga0075370_10325798 3300006353 Bacteria 915
772 Ga0075370_10383044 3300006353 Bacteria 843
773 Ga0075370_10794383 3300006353 Bacteria 577
774 Ga0068871_100228799 3300006358 Bacteria 1613
775 Ga0068871_100393180 3300006358 Bacteria 1233
776 Ga0068871_100659861 3300006358 Bacteria 955
777 Ga0068871_100669295 3300006358 Bacteria 949
778 Ga0068871_100721204 3300006358 Bacteria 915
779 Ga0075431_101456190 3300006847 Bacteria 644
780 Ga0075431_101540001 3300006847 Bacteria 623
781 Ga0068865_100071838 3300006881 Bacteria 2456
782 Ga0068865_100234304 3300006881 Bacteria 1442
783 Ga0068865_101111409 3300006881 Bacteria 696
784 Ga0075436_100178041 3300006914 Bacteria 1502
785 Ga0075436_100724719 3300006914 Bacteria 737
786 Ga0097620_100448238 3300006931 Bacteria 1387
787 Ga0097620_101149436 3300006931 Bacteria 854
788 Ga0097620_102558128 3300006931 Bacteria 562
789 Ga0099823_1024919 3300006944 Bacteria 5381
790 Ga0079104_1005406 3300006946 Bacteria 5112
791 Ga0079104_1032881 3300006946 Bacteria 1274
792 Ga0099826_10036954 3300006948 Bacteria 3447
793 Ga0099826_10059291 3300006948 Bacteria 2503
794 Ga0099826_10102560 3300006948 Bacteria 1722
795 Ga0105251_10003171 3300009011 Bacteria 12170
796 Ga0105251_10003747 3300009011 Bacteria 10880
797 Ga0105251_10018245 3300009011 Bacteria 3736
798 Ga0105244_10014959 3300009036 Bacteria 4464
799 Ga0105244_10051039 3300009036 Bacteria 2109
800 Ga0105244_10053267 3300009036 Bacteria 2057
801 Ga0105244_10072659 3300009036 Bacteria 1713
802 Ga0105244_10103162 3300009036 Bacteria 1393
803 Ga0105244_10384474 3300009036 Bacteria 646
804 Ga0105250_10384358 3300009092 Bacteria 620
805 Ga0105250_10506389 3300009092 Bacteria 548
806 Ga0105240_10001149 3300009093 Bacteria 46318
807 Ga0105240_10029309 3300009093 Bacteria 7174
808 Ga0105240_10058398 3300009093 Bacteria 4816
809 Ga0105240_10113841 3300009093 Bacteria 3269
810 Ga0105240_10157226 3300009093 Bacteria 2702
811 Ga0105240_10159725 3300009093 Bacteria 2678
812 Ga0105240_10197401 3300009093 Bacteria 2361
813 Ga0105240_10274006 3300009093 Bacteria 1942
814 Ga0105240_10391938 3300009093 Bacteria 1566
815 Ga0105240_10501699 3300009093 Bacteria 1349
816 Ga0105240_10829768 3300009093 Bacteria 999
817 Ga0105240_11268861 3300009093 Bacteria 778
818 Ga0105240_11478161 3300009093 Bacteria 713
819 Ga0105240_11608021 3300009093 Bacteria 680
820 Ga0105240_11935306 3300009093 Bacteria 613
821 Ga0111539_10533653 3300009094 Bacteria 1367
822 Ga0111539_10989556 3300009094 Bacteria 978
823 Ga0111539_11863773 3300009094 Bacteria 697
824 Ga0105245_10080216 3300009098 Bacteria 2981
825 Ga0105245_10090047 3300009098 Bacteria 2821
826 Ga0105245_10207953 3300009098 Bacteria 1882
827 Ga0105245_11431938 3300009098 Bacteria 741
828 Ga0105245_11877468 3300009098 Bacteria 652
829 Ga0105247_10001324 3300009101 Bacteria 18074
830 Ga0105247_10318646 3300009101 Bacteria 1084
831 Ga0105247_10521638 3300009101 Bacteria 869
832 Ga0105247_11470220 3300009101 Bacteria 554
833 Ga0114129_12250344 3300009147 Bacteria 655
834 Ga0105243_10036695 3300009148 Bacteria 3806
835 Ga0105243_10063811 3300009148 Bacteria 2953
836 Ga0105243_10205661 3300009148 Bacteria 1730
837 Ga0105243_10513432 3300009148 Bacteria 1138
838 Ga0105243_10756434 3300009148 Bacteria 953
839 Ga0105243_12002865 3300009148 Bacteria 613
840 Ga0105243_12842080 3300009148 Bacteria 525
841 Ga0105241_10087830 3300009174 Bacteria 2448
842 Ga0105241_10143213 3300009174 Bacteria 1948
843 Ga0105241_10378260 3300009174 Bacteria 1237
844 Ga0105241_10747461 3300009174 Bacteria 897
845 Ga0105241_10795845 3300009174 Bacteria 871
846 Ga0105241_10896043 3300009174 Bacteria 823
847 Ga0105241_10937519 3300009174 Bacteria 806
848 Ga0105241_11454355 3300009174 Bacteria 658
849 Ga0105242_10409436 3300009176 Bacteria 1268
850 Ga0105242_10893184 3300009176 Bacteria 888
851 Ga0105242_11460796 3300009176 Bacteria 713
852 Ga0105242_11688903 3300009176 Bacteria 669
853 Ga0105242_11870150 3300009176 Bacteria 640
854 Ga0105242_11874289 3300009176 Bacteria 639
855 Ga0105242_12111774 3300009176 Bacteria 607
856 Ga0105248_10046830 3300009177 Bacteria 4848
857 Ga0105248_10052664 3300009177 Bacteria 4567
858 Ga0105248_10477317 3300009177 Bacteria 1406
859 Ga0105248_10497936 3300009177 Bacteria 1374
860 Ga0105248_10656313 3300009177 Bacteria 1184
861 Ga0105248_10682515 3300009177 Bacteria 1159
862 Ga0105248_10785422 3300009177 Bacteria 1075
863 Ga0105248_11237000 3300009177 Bacteria 844
864 Ga0105248_11868210 3300009177 Bacteria 681
865 Ga0105237_10025280 3300009545 Bacteria 6073
866 Ga0105237_10044221 3300009545 Bacteria 4484
867 Ga0105237_10050085 3300009545 Bacteria 4197
868 Ga0105237_10051347 3300009545 Bacteria 4141
869 Ga0105237_10073900 3300009545 Bacteria 3401
870 Ga0105237_10197637 3300009545 Bacteria 2010
871 Ga0105237_10331902 3300009545 Bacteria 1525
872 Ga0105237_10776940 3300009545 Bacteria 964
873 Ga0105237_11237717 3300009545 Bacteria 753
874 Ga0105237_12749061 3300009545 Bacteria 503
875 Ga0105238_10022011 3300009551 Bacteria 6496
876 Ga0105238_10039356 3300009551 Bacteria 4794
877 Ga0105238_10069516 3300009551 Bacteria 3522
878 Ga0105238_10194845 3300009551 Bacteria 2002
879 Ga0105238_10208375 3300009551 Bacteria 1931
880 Ga0105238_10229232 3300009551 Bacteria 1834
881 Ga0105238_10431968 3300009551 Bacteria 1313
882 Ga0105238_10505322 3300009551 Bacteria 1210
883 Ga0105238_10580839 3300009551 Bacteria 1127
884 Ga0105238_10859640 3300009551 Bacteria 924
885 Ga0105238_11990834 3300009551 Bacteria 614
886 Ga0105249_10036583 3300009553 Bacteria 4454
887 Ga0105249_10397717 3300009553 Bacteria 1407
888 Ga0105249_10581513 3300009553 Bacteria 1173
889 Ga0105249_10660003 3300009553 Bacteria 1104
890 Ga0105249_10762586 3300009553 Bacteria 1030
891 Ga0105249_12520520 3300009553 Bacteria 587
892 Ga0105249_12794200 3300009553 Bacteria 560
893 Ga0105148_104783 3300009978 Bacteria 973
894 Ga0105032_103281 3300009979 Bacteria 1410
895 Ga0105029_100378 3300009984 Bacteria 2323
896 Ga0105033_115349 3300009986 Bacteria 685
897 Ga0105239_10006660 3300010375 Bacteria 13359
898 Ga0105239_10029678 3300010375 Bacteria 6014
899 Ga0105239_10053763 3300010375 Bacteria 4416
900 Ga0105239_10072506 3300010375 Bacteria 3786
901 Ga0105239_10107225 3300010375 Bacteria 3095
902 Ga0105239_10198957 3300010375 Bacteria 2244
903 Ga0105239_10232732 3300010375 Bacteria 2067
904 Ga0105239_10243349 3300010375 Bacteria 2019
905 Ga0105239_10475703 3300010375 Bacteria 1419
906 Ga0105239_10797249 3300010375 Bacteria 1082
907 Ga0105239_10865749 3300010375 Bacteria 1037
908 Ga0105239_12879247 3300010375 Bacteria 561
909 Ga0105246_10283799 3300011119 Bacteria 1329
910 Ga0105246_10544156 3300011119 Bacteria 994
911 Ga0105246_11823845 3300011119 Bacteria 582
912 Ga0157317_1000375 3300012475 Bacteria 1817
913 Ga0157317_1016544 3300012475 Bacteria 622
914 Ga0157344_1002139 3300012476 Bacteria 1021
915 Ga0157336_1033126 3300012477 Bacteria 526
916 Ga0157328_1005054 3300012478 Bacteria 756
917 Ga0157328_1006916 3300012478 Bacteria 703
918 Ga0157346_1001495 3300012480 Bacteria 1117
919 Ga0157346_1016123 3300012480 Bacteria 606
920 Ga0157318_1000454 3300012482 Bacteria 1736
921 Ga0157318_1000586 3300012482 Bacteria 1607
922 Ga0157337_1002148 3300012483 Bacteria 1090
923 Ga0157337_1005879 3300012483 Bacteria 833
924 Ga0157337_1039178 3300012483 Bacteria 516
925 Ga0157325_1003419 3300012485 Bacteria 874
926 Ga0157321_1005337 3300012487 Bacteria 840
927 Ga0157343_1000309 3300012488 Bacteria 1875
928 Ga0157343_1013361 3300012488 Bacteria 662
929 Ga0157322_1006598 3300012490 Bacteria 835
930 Ga0157329_1003027 3300012491 Bacteria 1002
931 Ga0157329_1042870 3300012491 Bacteria 513
932 Ga0157335_1009945 3300012492 Bacteria 756
933 Ga0157341_1014564 3300012494 Bacteria 715
934 Ga0157323_1001577 3300012495 Bacteria 1163
935 Ga0157323_1001641 3300012495 Bacteria 1151
936 Ga0157319_1001759 3300012497 Bacteria 1164
937 Ga0157319_1004824 3300012497 Bacteria 903
938 Ga0157319_1017079 3300012497 Bacteria 666
939 Ga0157319_1017527 3300012497 Bacteria 662
940 Ga0157319_1035886 3300012497 Bacteria 558
941 Ga0157345_1004272 3300012498 Bacteria 1067
942 Ga0157345_1031286 3300012498 Bacteria 598
943 Ga0157314_1003532 3300012500 Bacteria 1116
944 Ga0157314_1003888 3300012500 Bacteria 1077
945 Ga0157339_1001246 3300012505 Bacteria 1519
946 Ga0157339_1007725 3300012505 Bacteria 910
947 Ga0157339_1030069 3300012505 Bacteria 630
948 Ga0157324_1002058 3300012506 Bacteria 1191
949 Ga0157324_1005105 3300012506 Bacteria 936
950 Ga0157324_1011096 3300012506 Bacteria 775
951 Ga0157342_1002786 3300012507 Bacteria 1450
952 Ga0157315_1001215 3300012508 Bacteria 1386
953 Ga0157316_1000423 3300012510 Bacteria 2198
954 Ga0157316_1001459 3300012510 Bacteria 1470
955 Ga0157316_1052548 3300012510 Bacteria 567
956 Ga0157327_1013073 3300012512 Bacteria 828
957 Ga0157327_1058496 3300012512 Bacteria 568
958 Ga0157326_1006150 3300012513 Bacteria 1278
959 Ga0157326_1007245 3300012513 Bacteria 1197
960 Ga0157338_1000253 3300012515 Bacteria 2875
961 Ga0157373_10026614 3300013100 Bacteria 4175
962 Ga0157373_10037570 3300013100 Bacteria 3471
963 Ga0157373_10039069 3300013100 Bacteria 3398
964 Ga0157373_10162162 3300013100 Bacteria 1573
965 Ga0157373_10199115 3300013100 Bacteria 1412
966 Ga0157373_10630228 3300013100 Bacteria 782
967 Ga0157373_10747563 3300013100 Bacteria 719
968 Ga0157371_10025254 3300013102 Bacteria 4332
969 Ga0157371_10099791 3300013102 Bacteria 2059
970 Ga0157371_10114710 3300013102 Bacteria 1913
971 Ga0157371_10132466 3300013102 Bacteria 1774
972 Ga0157371_10142030 3300013102 Bacteria 1710
973 Ga0157371_10214782 3300013102 Bacteria 1381
974 Ga0157371_10357405 3300013102 Bacteria 1064
975 Ga0157371_10483637 3300013102 Bacteria 913
976 Ga0157371_10612843 3300013102 Bacteria 810
977 Ga0157371_10648800 3300013102 Bacteria 788
978 Ga0157371_11473246 3300013102 Bacteria 530
979 Ga0157371_11490750 3300013102 Bacteria 527
980 Ga0157370_10062752 3300013104 Bacteria 3523
981 Ga0157370_10073111 3300013104 Bacteria 3235
982 Ga0157370_10175248 3300013104 Bacteria 1993
983 Ga0157370_10282120 3300013104 Bacteria 1535
984 Ga0157370_10313849 3300013104 Bacteria 1446
985 Ga0157370_10327837 3300013104 Bacteria 1412
986 Ga0157370_10333870 3300013104 Bacteria 1397
987 Ga0157370_10340959 3300013104 Bacteria 1381
988 Ga0157370_10524185 3300013104 Bacteria 1087
989 Ga0157370_10734321 3300013104 Bacteria 900
990 Ga0157370_10953303 3300013104 Bacteria 778
991 Ga0157370_11421509 3300013104 Bacteria 624
992 Ga0157370_11890703 3300013104 Bacteria 535
993 Ga0157369_10004613 3300013105 Bacteria 16198
994 Ga0157369_10023079 3300013105 Bacteria 6933
995 Ga0157369_10029397 3300013105 Bacteria 6073
996 Ga0157369_10036937 3300013105 Bacteria 5351
997 Ga0157369_10053594 3300013105 Bacteria 4358
998 Ga0157369_10097097 3300013105 Bacteria 3143
999 Ga0157369_10127097 3300013105 Bacteria 2702
1000 Ga0157369_10421157 3300013105 Bacteria 1384
1001 Ga0157369_10422405 3300013105 Bacteria 1382
1002 Ga0157369_10456990 3300013105 Bacteria 1322
1003 Ga0157369_10480209 3300013105 Bacteria 1286
1004 Ga0157369_10502446 3300013105 Bacteria 1254
1005 Ga0157369_10898137 3300013105 Bacteria 909
1006 Ga0157369_12570683 3300013105 Bacteria 515
1007 Ga0157369_12643170 3300013105 Bacteria 507
1008 Ga0157374_10130368 3300013296 Bacteria 2433
1009 Ga0157374_10245726 3300013296 Bacteria 1760
1010 Ga0157374_10565436 3300013296 Bacteria 1145
1011 Ga0157378_10023199 3300013297 Bacteria 5461
1012 Ga0157378_10131466 3300013297 Bacteria 2317
1013 Ga0157378_10976184 3300013297 Bacteria 880
1014 Ga0157378_12285307 3300013297 Bacteria 592
1015 Ga0157378_12490850 3300013297 Bacteria 569
1016 Ga0163162_10001854 3300013306 Bacteria 19906
1017 Ga0163162_10281125 3300013306 Bacteria 1796
1018 Ga0163162_10283689 3300013306 Bacteria 1788
1019 Ga0163162_10983754 3300013306 Bacteria 953
1020 Ga0163162_12354844 3300013306 Bacteria 612
1021 Ga0163162_12731804 3300013306 Bacteria 568
1022 Ga0163162_12764934 3300013306 Bacteria 565
1023 Ga0163162_13452503 3300013306 Bacteria 503
1024 Ga0157372_10030525 3300013307 Bacteria 5896
1025 Ga0157372_10045136 3300013307 Bacteria 4887
1026 Ga0157372_10076736 3300013307 Bacteria 3773
1027 Ga0157372_10082823 3300013307 Bacteria 3633
1028 Ga0157372_10093730 3300013307 Bacteria 3418
1029 Ga0157372_10148669 3300013307 Bacteria 2702
1030 Ga0157372_10273674 3300013307 Bacteria 1962
1031 Ga0157372_10592496 3300013307 Bacteria 1292
1032 Ga0157372_10674149 3300013307 Bacteria 1204
1033 Ga0157372_10751529 3300013307 Bacteria 1134
1034 Ga0157372_10834864 3300013307 Bacteria 1070
1035 Ga0157372_11664969 3300013307 Bacteria 734
1036 Ga0157372_13309861 3300013307 Bacteria 513
1037 Ga0157372_13473563 3300013307 Bacteria 501
1038 Ga0157375_10340510 3300013308 Bacteria 1665
1039 Ga0157375_10347661 3300013308 Bacteria 1649
1040 Ga0157375_10602389 3300013308 Bacteria 1258
1041 Ga0157375_10658115 3300013308 Bacteria 1203
1042 Ga0157375_11312631 3300013308 Bacteria 851
1043 Ga0157375_12950984 3300013308 Bacteria 568
1044 Ga0163163_10525946 3300014325 Bacteria 1245
1045 Ga0163163_10886479 3300014325 Bacteria 955
1046 Ga0157380_10454896 3300014326 Bacteria 1231
1047 Ga0157380_10749650 3300014326 Bacteria 988
1048 Ga0157380_12272442 3300014326 Bacteria 607
1049 Ga0157380_12754044 3300014326 Bacteria 558
1050 Ga0157380_13474071 3300014326 Bacteria 504
1051 Ga0182008_10003539 3300014497 Bacteria 9385
1052 Ga0182008_10003930 3300014497 Bacteria 8796
1053 Ga0182008_10123612 3300014497 Bacteria 1287
1054 Ga0182008_10137597 3300014497 Bacteria 1220
1055 Ga0182008_10141939 3300014497 Bacteria 1202
1056 Ga0182008_10193644 3300014497 Bacteria 1032
1057 Ga0182008_10201668 3300014497 Bacteria 1012
1058 Ga0182008_10457886 3300014497 Bacteria 695
1059 Ga0182008_10481862 3300014497 Bacteria 679
1060 Ga0182008_10929877 3300014497 Bacteria 514
1061 Ga0157377_10197807 3300014745 Bacteria 1274
1062 Ga0157379_10223219 3300014968 Bacteria 1707
1063 Ga0157379_10283114 3300014968 Bacteria 1509
1064 Ga0157379_10325002 3300014968 Bacteria 1405
1065 Ga0157379_10687348 3300014968 Bacteria 960
1066 Ga0157376_10009877 3300014969 Bacteria 6959
1067 Ga0157376_10120992 3300014969 Bacteria 2320
1068 Ga0157376_10801918 3300014969 Bacteria 954
1069 Ga0157376_11275532 3300014969 Bacteria 764
1070 Ga0157376_11717232 3300014969 Bacteria 663
1071 Ga0182006_1002396 3300015261 Bacteria 10274
1072 Ga0182006_1010232 3300015261 Bacteria 4178
1073 Ga0182006_1028641 3300015261 Bacteria 2263
1074 Ga0182006_1060043 3300015261 Bacteria 1438
1075 Ga0182006_1082397 3300015261 Bacteria 1171
1076 Ga0182006_1098157 3300015261 Bacteria 1043
1077 Ga0182006_1120228 3300015261 Bacteria 913
1078 Ga0182006_1162819 3300015261 Bacteria 751
1079 Ga0182007_10001054 3300015262 Bacteria 15057
1080 Ga0182007_10003528 3300015262 Bacteria 7366
1081 Ga0182007_10043580 3300015262 Bacteria 1490
1082 Ga0182007_10155126 3300015262 Bacteria 780
1083 Ga0182007_10280660 3300015262 Bacteria 606
1084 Ga0182007_10441466 3300015262 Bacteria 500
1085 Ga0182005_1014484 3300015265 Bacteria 2205
1086 Ga0182005_1055144 3300015265 Bacteria 1083
1087 Ga0182005_1101035 3300015265 Bacteria 808
1088 Ga0183362_10007 3300015683 Bacteria 240101
1089 Ga0183369_1007 3300015685 Bacteria 414878
1090 Ga0183368_1002 3300015687 Bacteria 1865598
1091 Ga0183360_10001 3300015689 Bacteria 3943671
1092 Ga0163161_10190066 3300017792 Bacteria 1578
1093 Ga0163161_10230968 3300017792 Bacteria 1436
1094 Ga0163161_10262781 3300017792 Bacteria 1348
1095 Ga0163161_10412031 3300017792 Bacteria 1086
1096 Ga0163161_10786293 3300017792 Bacteria 799
1097 Ga0163161_10942925 3300017792 Bacteria 734
1098 Ga0163161_10994031 3300017792 Bacteria 716
1099 Ga0163161_11113116 3300017792 Bacteria 679
1100 Ga0184592_105364 3300019177 Bacteria 2645
1101 Ga0197907_10107589 3300020069 Bacteria 1910
1102 Ga0197907_10134550 3300020069 Bacteria 519
1103 Ga0206356_10069576 3300020070 Bacteria 3317
1104 Ga0206356_10382875 3300020070 Bacteria 1100
1105 Ga0206356_10444783 3300020070 Bacteria 534
1106 Ga0206356_10446557 3300020070 Bacteria 1214
1107 Ga0206356_11514200 3300020070 Bacteria 2326
1108 Ga0206356_11731388 3300020070 Bacteria 758
1109 Ga0206349_1449394 3300020075 Bacteria 702
1110 Ga0206355_1097630 3300020076 Bacteria 732
1111 Ga0206355_1206608 3300020076 Bacteria 992
1112 Ga0206355_1347985 3300020076 Bacteria 4206
1113 Ga0206355_1392352 3300020076 Bacteria 1058
1114 Ga0206355_1568832 3300020076 Bacteria 622
1115 Ga0206351_10137113 3300020077 Bacteria 748
1116 Ga0206351_10247550 3300020077 Bacteria 8297
1117 Ga0206351_10721784 3300020077 Bacteria 2811
1118 Ga0206352_10668756 3300020078 Bacteria 1188
1119 Ga0206352_11092907 3300020078 Bacteria 7966
1120 Ga0206352_11190509 3300020078 Bacteria 1049
1121 Ga0206352_11332379 3300020078 Bacteria 536
1122 Ga0206350_10079206 3300020080 Bacteria 2312
1123 Ga0206350_10101126 3300020080 Bacteria 584
1124 Ga0206350_10601137 3300020080 Bacteria 3515
1125 Ga0206350_11418185 3300020080 Bacteria 831
1126 Ga0206354_10159778 3300020081 Bacteria 7584
1127 Ga0206354_11635997 3300020081 Bacteria 1801
1128 Ga0206353_10078560 3300020082 Bacteria 773
1129 Ga0206353_10129542 3300020082 Bacteria 10452
1130 Ga0206353_10294942 3300020082 Bacteria 4933
1131 Ga0206353_10514404 3300020082 Bacteria 1220
1132 Ga0206353_11707293 3300020082 Bacteria 629
1133 Ga0154015_1010654 3300020610 Bacteria 5497
1134 Ga0154015_1040205 3300020610 Bacteria 520
1135 Ga0154015_1144278 3300020610 Bacteria 574
1136 Ga0154015_1554875 3300020610 Bacteria 1135
1137 Ga0224712_10002283 3300022467 Bacteria 4695
1138 Ga0224712_10003939 3300022467 Bacteria 3939
1139 Ga0224712_10093803 3300022467 Bacteria 1262
1140 Ga0224712_10158132 3300022467 Bacteria 1009
1141 Ga0256744_133841 3300023309 Bacteria 552
1142 Ga0209435_100019 3300025206 Bacteria 260989
1143 Ga0209435_105832 3300025206 Bacteria 1379
1144 Ga0209435_128097 3300025206 Bacteria 513
1145 Ga0209760_100117 3300025207 Bacteria 57229
1146 Ga0209760_100346 3300025207 Bacteria 13346
1147 Ga0209760_101310 3300025207 Bacteria 2703
1148 Ga0209436_103689 3300025208 Bacteria 3985
1149 Ga0209436_118242 3300025208 Bacteria 1002
1150 Ga0209784_100060 3300025224 Bacteria 164838
1151 Ga0209784_100167 3300025224 Bacteria 56563
1152 Ga0209566_100075 3300025225 Bacteria 164838
1153 Ga0209566_102636 3300025225 Bacteria 3164
1154 Ga0209674_100043 3300025226 Bacteria 369728
1155 Ga0209674_100100 3300025226 Bacteria 164838
1156 Ga0209674_100381 3300025226 Bacteria 23509
1157 Ga0209674_102055 3300025226 Bacteria 4611
1158 Ga0209672_100004 3300025228 Bacteria 1467504
1159 Ga0209672_100029 3300025228 Bacteria 339298
1160 Ga0209672_101110 3300025228 Bacteria 11367
1161 Ga0209672_101179 3300025228 Bacteria 10647
1162 Ga0209672_102109 3300025228 Bacteria 5311
1163 Ga0209672_104042 3300025228 Bacteria 2830
1164 Ga0209147_100096 3300025229 Bacteria 164838
1165 Ga0209147_101231 3300025229 Bacteria 10201
1166 Ga0209563_100103 3300025230 Bacteria 151835
1167 Ga0209563_100195 3300025230 Bacteria 33338
1168 Ga0207427_100144 3300025231 Bacteria 82742
1169 Ga0207427_100209 3300025231 Bacteria 53322
1170 Ga0207427_100327 3300025231 Bacteria 31981
1171 Ga0207427_103986 3300025231 Bacteria 2704
1172 Ga0209437_100020 3300025233 Bacteria 656374
1173 Ga0209437_100193 3300025233 Bacteria 122027
1174 Ga0209437_100256 3300025233 Bacteria 82734
1175 Ga0209437_100465 3300025233 Bacteria 31828
1176 Ga0209437_106609 3300025233 Bacteria 1922
1177 Ga0209437_122720 3300025233 Bacteria 731
1178 Ga0209258_100003 3300025242 Bacteria 1467504
1179 Ga0209258_100053 3300025242 Bacteria 339233
1180 Ga0209258_100149 3300025242 Bacteria 162184
1181 Ga0209258_100329 3300025242 Bacteria 71786
1182 Ga0209258_100387 3300025242 Bacteria 56263
1183 Ga0209258_100696 3300025242 Bacteria 23018
1184 Ga0209258_103384 3300025242 Bacteria 3457
1185 Ga0207425_1000117 3300025245 Bacteria 74911
1186 Ga0207425_1000562 3300025245 Bacteria 21887
1187 Ga0207425_1007236 3300025245 Bacteria 2952
1188 Ga0207425_1015555 3300025245 Bacteria 1704
1189 Ga0207425_1053279 3300025245 Bacteria 732
1190 Ga0209646_1000038 3300025246 Bacteria 353982
1191 Ga0209646_1000276 3300025246 Bacteria 45523
1192 Ga0209646_1000796 3300025246 Bacteria 10762
1193 Ga0209646_1002116 3300025246 Bacteria 4623
1194 Ga0209646_1002559 3300025246 Bacteria 3958
1195 Ga0209026_1000048 3300025250 Bacteria 257264
1196 Ga0209026_1000060 3300025250 Bacteria 220052
1197 Ga0209026_1000274 3300025250 Bacteria 61312
1198 Ga0209026_1000293 3300025250 Bacteria 55650
1199 Ga0209026_1000516 3300025250 Bacteria 27200
1200 Ga0209026_1001271 3300025250 Bacteria 11502
1201 Ga0209026_1020399 3300025250 Bacteria 1030
1202 Ga0209677_100057 3300025253 Bacteria 164838
1203 Ga0209677_101383 3300025253 Bacteria 10556
1204 Ga0209148_1000002 3300025254 Bacteria 2399500
1205 Ga0209148_1000009 3300025254 Bacteria 1395625
1206 Ga0209148_1000010 3300025254 Bacteria 1265567
1207 Ga0209148_1000025 3300025254 Bacteria 663262
1208 Ga0209148_1000039 3300025254 Bacteria 482479
1209 Ga0209148_1000122 3300025254 Bacteria 186071
1210 Ga0209148_1000143 3300025254 Bacteria 162184
1211 Ga0209148_1002653 3300025254 Bacteria 5782
1212 Ga0209759_1000038 3300025256 Bacteria 257264
1213 Ga0209759_1000658 3300025256 Bacteria 32027
1214 Ga0209759_1001361 3300025256 Bacteria 14147
1215 Ga0209759_1001919 3300025256 Bacteria 10178
1216 Ga0209759_1002020 3300025256 Bacteria 9629
1217 Ga0209759_1003338 3300025256 Bacteria 6440
1218 Ga0209759_1007439 3300025256 Bacteria 3520
1219 Ga0209759_1042567 3300025256 Bacteria 767
1220 Ga0209129_1000011 3300025258 Bacteria 568657
1221 Ga0209129_1000835 3300025258 Bacteria 19351
1222 Ga0209129_1002898 3300025258 Bacteria 7887
1223 Ga0209129_1005151 3300025258 Bacteria 4767
1224 Ga0209129_1021901 3300025258 Bacteria 1163
1225 Ga0209233_1000009 3300025261 Bacteria 1265567
1226 Ga0209233_1000020 3300025261 Bacteria 798224
1227 Ga0209233_1000133 3300025261 Bacteria 202716
1228 Ga0209233_1000151 3300025261 Bacteria 176515
1229 Ga0209233_1000870 3300025261 Bacteria 13292
1230 Ga0209233_1000920 3300025261 Bacteria 12852
1231 Ga0209233_1012013 3300025261 Bacteria 2526
1232 Ga0209565_1000001 3300025263 Bacteria 2950419
1233 Ga0209565_1000309 3300025263 Bacteria 45428
1234 Ga0209565_1000415 3300025263 Bacteria 35224
1235 Ga0209565_1007212 3300025263 Bacteria 3024
1236 Ga0209565_1019609 3300025263 Bacteria 1441
1237 Ga0209455_1000004 3300025272 Bacteria 1467504
1238 Ga0209455_1000034 3300025272 Bacteria 483129
1239 Ga0209455_1000060 3300025272 Bacteria 339298
1240 Ga0209455_1000086 3300025272 Bacteria 244650
1241 Ga0209455_1000095 3300025272 Bacteria 217487
1242 Ga0209455_1011194 3300025272 Bacteria 2225
1243 Ga0209455_1043089 3300025272 Bacteria 673
1244 Ga0209673_1000001 3300025273 Bacteria 3176258
1245 Ga0209673_1000088 3300025273 Bacteria 204629
1246 Ga0209673_1000204 3300025273 Bacteria 119618
1247 Ga0209673_1000690 3300025273 Bacteria 48324
1248 Ga0209673_1002116 3300025273 Bacteria 14881
1249 Ga0209673_1036952 3300025273 Bacteria 1441
1250 Ga0209673_1084364 3300025273 Bacteria 719
1251 Ga0209130_1003085 3300025284 Bacteria 7454
1252 Ga0209130_1004268 3300025284 Bacteria 5533
1253 Ga0209130_1007816 3300025284 Bacteria 3243
1254 Ga0209130_1008830 3300025284 Bacteria 2933
1255 Ga0209130_1012588 3300025284 Bacteria 2205
1256 Ga0209675_1000001 3300025291 Bacteria 2950293
1257 Ga0209675_1000015 3300025291 Bacteria 403517
1258 Ga0209675_1000093 3300025291 Bacteria 140158
1259 Ga0209675_1001254 3300025291 Bacteria 15221
1260 Ga0209675_1003419 3300025291 Bacteria 7558
1261 Ga0209675_1005023 3300025291 Bacteria 5668
1262 Ga0209675_1006904 3300025291 Bacteria 4460
1263 Ga0209676_1000110 3300025292 Bacteria 214083
1264 Ga0209676_1000156 3300025292 Bacteria 163255
1265 Ga0209676_1001499 3300025292 Bacteria 21342
1266 Ga0209676_1001608 3300025292 Bacteria 20029
1267 Ga0209676_1004379 3300025292 Bacteria 7893
1268 Ga0209676_1004892 3300025292 Bacteria 7229
1269 Ga0209676_1004912 3300025292 Bacteria 7197
1270 Ga0209676_1005292 3300025292 Bacteria 6803
1271 Ga0209676_1006351 3300025292 Bacteria 5858
1272 Ga0209676_1007252 3300025292 Bacteria 5261
1273 Ga0209676_1007792 3300025292 Bacteria 4930
1274 Ga0209025_1000002 3300025294 Bacteria 1393142
1275 Ga0209025_1000006 3300025294 Bacteria 1153444
1276 Ga0209025_1022034 3300025294 Bacteria 3400
1277 Ga0209025_1024539 3300025294 Bacteria 3106
1278 Ga0209025_1038555 3300025294 Bacteria 2099
1279 Ga0209025_1066487 3300025294 Bacteria 1309
1280 Ga0209025_1073277 3300025294 Bacteria 1202
1281 Ga0209564_1000001 3300025295 Bacteria 3176258
1282 Ga0209564_1000037 3300025295 Bacteria 414794
1283 Ga0209564_1007141 3300025295 Bacteria 5828
1284 Ga0209564_1008261 3300025295 Bacteria 5173
1285 Ga0209564_1023162 3300025295 Bacteria 2166
1286 Ga0209564_1057033 3300025295 Bacteria 903
1287 Ga0209758_1000003 3300025297 Bacteria 1398533
1288 Ga0209758_1005974 3300025297 Bacteria 9015
1289 Ga0209758_1006854 3300025297 Bacteria 7968
1290 Ga0209758_1015882 3300025297 Bacteria 3866
1291 Ga0209758_1024237 3300025297 Bacteria 2710
1292 Ga0209758_1035768 3300025297 Bacteria 1952
1293 Ga0209758_1044980 3300025297 Bacteria 1607
1294 Ga0209758_1073799 3300025297 Bacteria 1061
1295 Ga0209050_1000008 3300025298 Bacteria 1144179
1296 Ga0209050_1000063 3300025298 Bacteria 314955
1297 Ga0209050_1000224 3300025298 Bacteria 125433
1298 Ga0209050_1001128 3300025298 Bacteria 32216
1299 Ga0209050_1003182 3300025298 Bacteria 12456
1300 Ga0209050_1016634 3300025298 Bacteria 2993
1301 Ga0209050_1025712 3300025298 Bacteria 1992
1302 Ga0209050_1032610 3300025298 Bacteria 1599
1303 Ga0209256_1000002 3300025299 Bacteria 1906740
1304 Ga0209256_1000096 3300025299 Bacteria 204629
1305 Ga0209256_1002932 3300025299 Bacteria 12813
1306 Ga0209256_1003821 3300025299 Bacteria 10090
1307 Ga0209256_1007814 3300025299 Bacteria 5148
1308 Ga0209256_1019390 3300025299 Bacteria 2166
1309 Ga0207426_1003657 3300025302 Bacteria 8109
1310 Ga0207426_1007056 3300025302 Bacteria 4759
1311 Ga0207426_1022436 3300025302 Bacteria 2166
1312 Ga0207426_1051574 3300025302 Bacteria 1222
1313 Ga0209051_1000005 3300025303 Bacteria 1142353
1314 Ga0209051_1000313 3300025303 Bacteria 75138
1315 Ga0209051_1000690 3300025303 Bacteria 37346
1316 Ga0209051_1001513 3300025303 Bacteria 19394
1317 Ga0209051_1009153 3300025303 Bacteria 5140
1318 Ga0209051_1009647 3300025303 Bacteria 4953
1319 Ga0209051_1021704 3300025303 Bacteria 2722
1320 Ga0209051_1026209 3300025303 Bacteria 2355
1321 Ga0209051_1034215 3300025303 Bacteria 1908
1322 Ga0209051_1040883 3300025303 Bacteria 1656
1323 Ga0209051_1092924 3300025303 Bacteria 833
1324 Ga0209257_1000031 3300025304 Bacteria 688770
1325 Ga0209257_1000129 3300025304 Bacteria 214155
1326 Ga0209257_1000163 3300025304 Bacteria 175355
1327 Ga0209257_1002665 3300025304 Bacteria 17133
1328 Ga0209257_1003420 3300025304 Bacteria 13647
1329 Ga0209257_1005259 3300025304 Bacteria 9234
1330 Ga0209257_1006382 3300025304 Bacteria 7632
1331 Ga0209257_1006637 3300025304 Bacteria 7356
1332 Ga0209257_1025983 3300025304 Bacteria 1986
1333 Ga0209257_1026773 3300025304 Bacteria 1934
1334 Ga0209257_1049327 3300025304 Bacteria 1199
1335 Ga0209257_1101832 3300025304 Bacteria 699
1336 Ga0207697_10131098 3300025315 Bacteria 1083
1337 Ga0207697_10280361 3300025315 Bacteria 739
1338 Ga0207697_10331186 3300025315 Bacteria 676
1339 Ga0207656_10000010 3300025321 Bacteria 192224
1340 Ga0207656_10011428 3300025321 Bacteria 3354
1341 Ga0207656_10014326 3300025321 Bacteria 3052
1342 Ga0207656_10061049 3300025321 Bacteria 1654
1343 Ga0207656_10068377 3300025321 Bacteria 1574
1344 Ga0207656_10079985 3300025321 Bacteria 1467
1345 Ga0207656_10404474 3300025321 Bacteria 686
1346 Ga0207656_10484483 3300025321 Bacteria 627
1347 Ga0207696_1000118 3300025711 Bacteria 147902
1348 Ga0207696_1005443 3300025711 Bacteria 5286
1349 Ga0207696_1211161 3300025711 Bacteria 508
1350 Ga0207655_1001405 3300025728 Bacteria 22434
1351 Ga0207655_1006327 3300025728 Bacteria 7866
1352 Ga0207655_1043489 3300025728 Bacteria 1899
1353 Ga0207655_1085698 3300025728 Bacteria 1123
1354 Ga0207713_1000294 3300025735 Bacteria 57476
1355 Ga0207713_1004451 3300025735 Bacteria 9073
1356 Ga0207713_1007360 3300025735 Bacteria 6510
1357 Ga0207713_1008183 3300025735 Bacteria 6052
1358 Ga0207713_1015828 3300025735 Bacteria 3853
1359 Ga0207682_10017956 3300025893 Bacteria 2762
1360 Ga0207682_10072846 3300025893 Bacteria 1458
1361 Ga0207682_10340283 3300025893 Bacteria 706
1362 Ga0207642_11001076 3300025899 Bacteria 538
1363 Ga0207710_10012197 3300025900 Bacteria 3615
1364 Ga0207688_10130022 3300025901 Bacteria 1475
1365 Ga0207688_10209947 3300025901 Bacteria 1169
1366 Ga0207680_10000013 3300025903 Bacteria 244716
1367 Ga0207680_10018972 3300025903 Bacteria 3670
1368 Ga0207680_10088435 3300025903 Bacteria 1964
1369 Ga0207680_10361413 3300025903 Bacteria 1021
1370 Ga0207680_10951788 3300025903 Bacteria 615
1371 Ga0207647_10000287 3300025904 Bacteria 41379
1372 Ga0207647_10011795 3300025904 Bacteria 6108
1373 Ga0207647_10012806 3300025904 Bacteria 5826
1374 Ga0207647_10032989 3300025904 Bacteria 3320
1375 Ga0207647_10072505 3300025904 Bacteria 2076
1376 Ga0207647_10104101 3300025904 Bacteria 1682
1377 Ga0207647_10165569 3300025904 Bacteria 1289
1378 Ga0207647_10320677 3300025904 Bacteria 880
1379 Ga0207685_10514704 3300025905 Bacteria 632
1380 Ga0207645_10151261 3300025907 Bacteria 1515
1381 Ga0207643_10104227 3300025908 Bacteria 1665
1382 Ga0207643_10451935 3300025908 Bacteria 817
1383 Ga0207705_10004273 3300025909 Bacteria 10819
1384 Ga0207705_10008046 3300025909 Bacteria 7728
1385 Ga0207705_10011179 3300025909 Bacteria 6507
1386 Ga0207705_10016228 3300025909 Bacteria 5342
1387 Ga0207705_10021621 3300025909 Bacteria 4591
1388 Ga0207705_10034450 3300025909 Bacteria 3620
1389 Ga0207705_10073017 3300025909 Bacteria 2489
1390 Ga0207705_10265294 3300025909 Bacteria 1312
1391 Ga0207705_10389212 3300025909 Bacteria 1077
1392 Ga0207705_10512598 3300025909 Bacteria 932
1393 Ga0207705_10692956 3300025909 Bacteria 792
1394 Ga0207705_11120956 3300025909 Bacteria 606
1395 Ga0207684_10466006 3300025910 Bacteria 1084
1396 Ga0207654_10184058 3300025911 Bacteria 1365
1397 Ga0207654_10320367 3300025911 Bacteria 1059
1398 Ga0207654_10478139 3300025911 Bacteria 877
1399 Ga0207707_10000210 3300025912 Bacteria 62292
1400 Ga0207707_10001339 3300025912 Bacteria 22957
1401 Ga0207707_10006555 3300025912 Bacteria 10160
1402 Ga0207707_10007311 3300025912 Bacteria 9616
1403 Ga0207707_10007312 3300025912 Bacteria 9616
1404 Ga0207707_10010320 3300025912 Bacteria 8104
1405 Ga0207707_10052498 3300025912 Bacteria 3549
1406 Ga0207707_10096300 3300025912 Bacteria 2586
1407 Ga0207707_10650591 3300025912 Bacteria 888
1408 Ga0207707_10772304 3300025912 Bacteria 802
1409 Ga0207707_11561028 3300025912 Bacteria 521
1410 Ga0207695_10000929 3300025913 Bacteria 52349
1411 Ga0207695_10006299 3300025913 Bacteria 15447
1412 Ga0207695_10008130 3300025913 Bacteria 13192
1413 Ga0207695_10016662 3300025913 Bacteria 8588
1414 Ga0207695_10022941 3300025913 Bacteria 7069
1415 Ga0207695_10030817 3300025913 Bacteria 5900
1416 Ga0207695_10068969 3300025913 Bacteria 3621
1417 Ga0207695_10073537 3300025913 Bacteria 3483
1418 Ga0207695_10089423 3300025913 Bacteria 3097
1419 Ga0207695_10221098 3300025913 Bacteria 1801
1420 Ga0207695_10231011 3300025913 Bacteria 1754
1421 Ga0207695_10549682 3300025913 Bacteria 1036
1422 Ga0207671_10000021 3300025914 Bacteria 300409
1423 Ga0207671_10000380 3300025914 Bacteria 62950
1424 Ga0207671_10028839 3300025914 Bacteria 4146
1425 Ga0207671_10033016 3300025914 Bacteria 3853
1426 Ga0207671_10166846 3300025914 Bacteria 1708
1427 Ga0207671_10348938 3300025914 Bacteria 1173
1428 Ga0207671_10419190 3300025914 Bacteria 1065
1429 Ga0207671_10624052 3300025914 Bacteria 859
1430 Ga0207671_10754760 3300025914 Bacteria 773
1431 Ga0207671_11008685 3300025914 Bacteria 656
1432 Ga0207693_10232042 3300025915 Bacteria 1449
1433 Ga0207693_11185482 3300025915 Bacteria 576
1434 Ga0207663_10139445 3300025916 Bacteria 1687
1435 Ga0207660_10036194 3300025917 Bacteria 3431
1436 Ga0207660_10047040 3300025917 Bacteria 3048
1437 Ga0207660_10115224 3300025917 Bacteria 2028
1438 Ga0207660_10119645 3300025917 Bacteria 1993
1439 Ga0207660_10188182 3300025917 Bacteria 1606
1440 Ga0207660_10201342 3300025917 Bacteria 1555
1441 Ga0207660_10412099 3300025917 Bacteria 1089
1442 Ga0207660_10555426 3300025917 Bacteria 934
1443 Ga0207660_10579106 3300025917 Bacteria 914
1444 Ga0207660_10616360 3300025917 Bacteria 884
1445 Ga0207660_10649311 3300025917 Bacteria 860
1446 Ga0207662_10346196 3300025918 Bacteria 997
1447 Ga0207662_10496826 3300025918 Bacteria 840
1448 Ga0207657_10006384 3300025919 Bacteria 12243
1449 Ga0207657_10023563 3300025919 Bacteria 5728
1450 Ga0207657_10055348 3300025919 Bacteria 3427
1451 Ga0207657_10090313 3300025919 Bacteria 2557
1452 Ga0207657_10097904 3300025919 Bacteria 2438
1453 Ga0207657_10206470 3300025919 Bacteria 1578
1454 Ga0207657_10214820 3300025919 Bacteria 1542
1455 Ga0207657_10256491 3300025919 Bacteria 1392
1456 Ga0207657_11130317 3300025919 Bacteria 598
1457 Ga0207649_10000041 3300025920 Bacteria 117781
1458 Ga0207649_10002213 3300025920 Bacteria 10987
1459 Ga0207649_10015186 3300025920 Bacteria 4325
1460 Ga0207649_10023404 3300025920 Bacteria 3577
1461 Ga0207649_10024587 3300025920 Bacteria 3503
1462 Ga0207649_10043228 3300025920 Bacteria 2753
1463 Ga0207649_10112764 3300025920 Bacteria 1820
1464 Ga0207649_10190994 3300025920 Bacteria 1440
1465 Ga0207649_10247664 3300025920 Bacteria 1282
1466 Ga0207649_10409589 3300025920 Bacteria 1016
1467 Ga0207649_10439918 3300025920 Bacteria 982
1468 Ga0207649_10580892 3300025920 Bacteria 860
1469 Ga0207649_11042938 3300025920 Bacteria 644
1470 Ga0207649_11666929 3300025920 Bacteria 505
1471 Ga0207652_10005745 3300025921 Bacteria 10069
1472 Ga0207652_10026548 3300025921 Bacteria 4825
1473 Ga0207652_10048121 3300025921 Bacteria 3644
1474 Ga0207652_10053020 3300025921 Bacteria 3483
1475 Ga0207652_10055937 3300025921 Bacteria 3395
1476 Ga0207652_10104588 3300025921 Bacteria 2504
1477 Ga0207652_10155814 3300025921 Bacteria 2046
1478 Ga0207652_10193163 3300025921 Bacteria 1831
1479 Ga0207652_10432066 3300025921 Bacteria 1187
1480 Ga0207652_10528373 3300025921 Bacteria 1061
1481 Ga0207652_10648648 3300025921 Bacteria 944
1482 Ga0207652_10752775 3300025921 Bacteria 867
1483 Ga0207652_11133565 3300025921 Bacteria 683
1484 Ga0207646_11197141 3300025922 Bacteria 666
1485 Ga0207681_10010421 3300025923 Bacteria 5688
1486 Ga0207681_10042588 3300025923 Bacteria 3033
1487 Ga0207681_10074212 3300025923 Bacteria 2382
1488 Ga0207681_10348828 3300025923 Bacteria 1184
1489 Ga0207681_10373981 3300025923 Bacteria 1146
1490 Ga0207681_11613591 3300025923 Bacteria 543
1491 Ga0207694_10007361 3300025924 Bacteria 8349
1492 Ga0207694_10016063 3300025924 Bacteria 5648
1493 Ga0207694_10017922 3300025924 Bacteria 5353
1494 Ga0207694_10028049 3300025924 Bacteria 4291
1495 Ga0207694_10028197 3300025924 Bacteria 4280
1496 Ga0207694_10129175 3300025924 Bacteria 2024
1497 Ga0207694_10299943 3300025924 Bacteria 1323
1498 Ga0207694_10424882 3300025924 Bacteria 1107
1499 Ga0207694_10648024 3300025924 Bacteria 890
1500 Ga0207694_10828510 3300025924 Bacteria 782
1501 Ga0207694_11863754 3300025924 Bacteria 505
1502 Ga0207650_10004000 3300025925 Bacteria 10085
1503 Ga0207650_10016653 3300025925 Bacteria 5138
1504 Ga0207650_10023595 3300025925 Bacteria 4364
1505 Ga0207650_10257240 3300025925 Bacteria 1415
1506 Ga0207650_10311221 3300025925 Bacteria 1288
1507 Ga0207650_10324590 3300025925 Bacteria 1261
1508 Ga0207650_10511625 3300025925 Bacteria 1004
1509 Ga0207650_10530806 3300025925 Bacteria 985
1510 Ga0207659_10518790 3300025926 Bacteria 1010
1511 Ga0207659_11050012 3300025926 Bacteria 701
1512 Ga0207659_11516365 3300025926 Bacteria 573
1513 Ga0207659_11684420 3300025926 Bacteria 540
1514 Ga0207687_10056115 3300025927 Bacteria 2762
1515 Ga0207687_10580124 3300025927 Bacteria 943
1516 Ga0207687_10792469 3300025927 Bacteria 808
1517 Ga0207687_11624171 3300025927 Bacteria 555
1518 Ga0207700_10040493 3300025928 Bacteria 3402
1519 Ga0207700_10280404 3300025928 Bacteria 1433
1520 Ga0207700_11637106 3300025928 Bacteria 569
1521 Ga0207664_10001884 3300025929 Bacteria 13792
1522 Ga0207664_10227762 3300025929 Bacteria 1619
1523 Ga0207664_10459231 3300025929 Bacteria 1137
1524 Ga0207644_10004894 3300025931 Bacteria 8728
1525 Ga0207644_10011422 3300025931 Bacteria 5875
1526 Ga0207644_10117662 3300025931 Bacteria 2018
1527 Ga0207644_10231687 3300025931 Bacteria 1468
1528 Ga0207644_10704874 3300025931 Bacteria 842
1529 Ga0207644_10875886 3300025931 Bacteria 752
1530 Ga0207690_10000291 3300025932 Bacteria 35587
1531 Ga0207690_10003289 3300025932 Bacteria 9676
1532 Ga0207690_10068444 3300025932 Bacteria 2439
1533 Ga0207690_10086236 3300025932 Bacteria 2206
1534 Ga0207690_10427079 3300025932 Bacteria 1061
1535 Ga0207690_11443849 3300025932 Bacteria 575
1536 Ga0207706_10015708 3300025933 Bacteria 6844
1537 Ga0207706_10019984 3300025933 Bacteria 6018
1538 Ga0207706_10035411 3300025933 Bacteria 4438
1539 Ga0207706_10066894 3300025933 Bacteria 3162
1540 Ga0207706_10271889 3300025933 Bacteria 1479
1541 Ga0207706_10375392 3300025933 Bacteria 1234
1542 Ga0207706_11426694 3300025933 Bacteria 567
1543 Ga0207686_10029651 3300025934 Bacteria 3230
1544 Ga0207686_10132394 3300025934 Bacteria 1712
1545 Ga0207686_10482903 3300025934 Bacteria 958
1546 Ga0207686_10689356 3300025934 Bacteria 811
1547 Ga0207686_11352752 3300025934 Bacteria 585
1548 Ga0207686_11784269 3300025934 Bacteria 509
1549 Ga0207709_10000030 3300025935 Bacteria 331710
1550 Ga0207709_10000421 3300025935 Bacteria 41092
1551 Ga0207709_10044385 3300025935 Bacteria 2685
1552 Ga0207709_10048725 3300025935 Bacteria 2583
1553 Ga0207709_10389491 3300025935 Bacteria 1063
1554 Ga0207670_10008334 3300025936 Bacteria 5845
1555 Ga0207670_10524637 3300025936 Bacteria 965
1556 Ga0207670_10564024 3300025936 Bacteria 932
1557 Ga0207669_10076663 3300025937 Bacteria 2123
1558 Ga0207669_10086024 3300025937 Bacteria 2031
1559 Ga0207669_10212828 3300025937 Bacteria 1412
1560 Ga0207669_10482142 3300025937 Bacteria 989
1561 Ga0207669_11205953 3300025937 Bacteria 641
1562 Ga0207669_11785760 3300025937 Bacteria 525
1563 Ga0207704_10017680 3300025938 Bacteria 3703
1564 Ga0207704_11103507 3300025938 Bacteria 674
1565 Ga0207704_11957973 3300025938 Bacteria 504
1566 Ga0207665_10227981 3300025939 Bacteria 1368
1567 Ga0207691_10076483 3300025940 Bacteria 3016
1568 Ga0207691_10092896 3300025940 Bacteria 2702
1569 Ga0207691_10107616 3300025940 Bacteria 2482
1570 Ga0207691_10205416 3300025940 Bacteria 1713
1571 Ga0207691_10483730 3300025940 Bacteria 1052
1572 Ga0207691_10866756 3300025940 Bacteria 757
1573 Ga0207711_10000272 3300025941 Bacteria 55799
1574 Ga0207711_10035850 3300025941 Bacteria 4206
1575 Ga0207711_10073580 3300025941 Bacteria 2970
1576 Ga0207711_10147290 3300025941 Bacteria 2122
1577 Ga0207711_10207309 3300025941 Bacteria 1790
1578 Ga0207711_10375480 3300025941 Bacteria 1319
1579 Ga0207711_10639839 3300025941 Bacteria 992
1580 Ga0207689_10030047 3300025942 Bacteria 4531
1581 Ga0207689_10034156 3300025942 Bacteria 4224
1582 Ga0207661_10004252 3300025944 Bacteria 10024
1583 Ga0207661_10014188 3300025944 Bacteria 5832
1584 Ga0207661_10034115 3300025944 Bacteria 3954
1585 Ga0207661_10207525 3300025944 Bacteria 1725
1586 Ga0207661_11050282 3300025944 Bacteria 750
1587 Ga0207679_10000081 3300025945 Bacteria 84888
1588 Ga0207679_10007494 3300025945 Bacteria 6926
1589 Ga0207679_10025524 3300025945 Bacteria 4065
1590 Ga0207679_10233122 3300025945 Bacteria 1555
1591 Ga0207679_10338335 3300025945 Bacteria 1308
1592 Ga0207679_10671473 3300025945 Bacteria 938
1593 Ga0207667_10008135 3300025949 Bacteria 12489
1594 Ga0207667_10008758 3300025949 Bacteria 11990
1595 Ga0207667_10009904 3300025949 Bacteria 11181
1596 Ga0207667_10010803 3300025949 Bacteria 10649
1597 Ga0207667_10034827 3300025949 Bacteria 5404
1598 Ga0207667_10053962 3300025949 Bacteria 4228
1599 Ga0207667_10054383 3300025949 Bacteria 4211
1600 Ga0207667_10056014 3300025949 Bacteria 4143
1601 Ga0207667_10058488 3300025949 Bacteria 4042
1602 Ga0207667_10069206 3300025949 Bacteria 3674
1603 Ga0207667_10072769 3300025949 Bacteria 3572
1604 Ga0207667_10083800 3300025949 Bacteria 3301
1605 Ga0207667_10263845 3300025949 Bacteria 1761
1606 Ga0207667_10405437 3300025949 Bacteria 1388
1607 Ga0207667_10557868 3300025949 Bacteria 1158
1608 Ga0207667_10882191 3300025949 Bacteria 887
1609 Ga0207667_11168526 3300025949 Bacteria 750
1610 Ga0207667_12132014 3300025949 Bacteria 519
1611 Ga0207651_10024704 3300025960 Bacteria 3722
1612 Ga0207651_10694860 3300025960 Bacteria 896
1613 Ga0207651_10997551 3300025960 Bacteria 748
1614 Ga0207651_11353849 3300025960 Bacteria 640
1615 Ga0207651_11796811 3300025960 Bacteria 552
1616 Ga0207712_10003232 3300025961 Bacteria 10354
1617 Ga0207712_10436855 3300025961 Bacteria 1107
1618 Ga0207712_10825864 3300025961 Bacteria 816
1619 Ga0207712_11160788 3300025961 Bacteria 688
1620 Ga0207668_10013075 3300025972 Bacteria 5100
1621 Ga0207668_10028680 3300025972 Bacteria 3642
1622 Ga0207668_10038934 3300025972 Bacteria 3195
1623 Ga0207668_10071707 3300025972 Bacteria 2475
1624 Ga0207668_10131935 3300025972 Bacteria 1909
1625 Ga0207668_10261487 3300025972 Bacteria 1410
1626 Ga0207668_10799855 3300025972 Bacteria 835
1627 Ga0207668_11130065 3300025972 Bacteria 703
1628 Ga0207668_11163965 3300025972 Bacteria 692
1629 Ga0207640_10002025 3300025981 Bacteria 10946
1630 Ga0207640_10002539 3300025981 Bacteria 9786
1631 Ga0207640_10003058 3300025981 Bacteria 9010
1632 Ga0207640_10025408 3300025981 Bacteria 3585
1633 Ga0207640_10026008 3300025981 Bacteria 3549
1634 Ga0207640_10075585 3300025981 Bacteria 2284
1635 Ga0207640_10081681 3300025981 Bacteria 2211
1636 Ga0207640_10108477 3300025981 Bacteria 1962
1637 Ga0207640_10112801 3300025981 Bacteria 1931
1638 Ga0207640_10140937 3300025981 Bacteria 1757
1639 Ga0207640_10181952 3300025981 Bacteria 1577
1640 Ga0207640_10238713 3300025981 Bacteria 1403
1641 Ga0207640_10867254 3300025981 Bacteria 786
1642 Ga0207640_11401481 3300025981 Bacteria 626
1643 Ga0207640_11421433 3300025981 Bacteria 622
1644 Ga0207640_11729958 3300025981 Bacteria 565
1645 Ga0207658_10000028 3300025986 Bacteria 174550
1646 Ga0207658_10033742 3300025986 Bacteria 3652
1647 Ga0207658_10054967 3300025986 Bacteria 2948
1648 Ga0207658_10182810 3300025986 Bacteria 1736
1649 Ga0207658_10184950 3300025986 Bacteria 1727
1650 Ga0207658_10407696 3300025986 Bacteria 1196
1651 Ga0207658_10485435 3300025986 Bacteria 1098
1652 Ga0207658_10691454 3300025986 Bacteria 921
1653 Ga0207658_10784915 3300025986 Bacteria 864
1654 Ga0207658_10830855 3300025986 Bacteria 839
1655 Ga0207658_11163925 3300025986 Bacteria 705
1656 Ga0207658_11786739 3300025986 Bacteria 561
1657 Ga0207677_10213528 3300026023 Bacteria 1543
1658 Ga0207677_10318665 3300026023 Bacteria 1291
1659 Ga0207677_11670871 3300026023 Bacteria 590
1660 Ga0207703_10111336 3300026035 Bacteria 2337
1661 Ga0207703_10497605 3300026035 Bacteria 1144
1662 Ga0207703_10978787 3300026035 Bacteria 811
1663 Ga0207703_11409684 3300026035 Bacteria 670
1664 Ga0207639_10000231 3300026041 Bacteria 41634
1665 Ga0207639_10000396 3300026041 Bacteria 30047
1666 Ga0207639_10001149 3300026041 Bacteria 18005
1667 Ga0207639_10016511 3300026041 Bacteria 5226
1668 Ga0207639_10024406 3300026041 Bacteria 4376
1669 Ga0207639_10029641 3300026041 Bacteria 4008
1670 Ga0207639_10047428 3300026041 Bacteria 3247
1671 Ga0207639_10062778 3300026041 Bacteria 2874
1672 Ga0207639_10070937 3300026041 Bacteria 2723
1673 Ga0207639_10104151 3300026041 Bacteria 2300
1674 Ga0207639_10291906 3300026041 Bacteria 1438
1675 Ga0207639_10427535 3300026041 Bacteria 1198
1676 Ga0207639_10485855 3300026041 Bacteria 1126
1677 Ga0207639_10532135 3300026041 Bacteria 1077
1678 Ga0207639_10582310 3300026041 Bacteria 1030
1679 Ga0207639_10686551 3300026041 Bacteria 949
1680 Ga0207639_10964200 3300026041 Bacteria 798
1681 Ga0207639_11258627 3300026041 Bacteria 694
1682 Ga0207639_11456762 3300026041 Bacteria 643
1683 Ga0207678_10016758 3300026067 Bacteria 6435
1684 Ga0207678_10047631 3300026067 Bacteria 3706
1685 Ga0207678_10049236 3300026067 Bacteria 3642
1686 Ga0207678_10049696 3300026067 Bacteria 3624
1687 Ga0207678_10054333 3300026067 Bacteria 3449
1688 Ga0207678_10055028 3300026067 Bacteria 3427
1689 Ga0207678_10057247 3300026067 Bacteria 3354
1690 Ga0207678_10094762 3300026067 Bacteria 2551
1691 Ga0207678_10103355 3300026067 Bacteria 2432
1692 Ga0207678_10151436 3300026067 Bacteria 1981
1693 Ga0207678_10219037 3300026067 Bacteria 1629
1694 Ga0207678_10224274 3300026067 Bacteria 1609
1695 Ga0207678_10242893 3300026067 Bacteria 1542
1696 Ga0207678_10253637 3300026067 Bacteria 1507
1697 Ga0207678_10289173 3300026067 Bacteria 1407
1698 Ga0207678_10432553 3300026067 Bacteria 1142
1699 Ga0207678_10571163 3300026067 Bacteria 990
1700 Ga0207708_10043595 3300026075 Bacteria 3419
1701 Ga0207708_10558693 3300026075 Bacteria 966
1702 Ga0207702_10000517 3300026078 Bacteria 43478
1703 Ga0207702_10000852 3300026078 Bacteria 31897
1704 Ga0207702_10011901 3300026078 Bacteria 7239
1705 Ga0207702_10012283 3300026078 Bacteria 7129
1706 Ga0207702_10022553 3300026078 Bacteria 5220
1707 Ga0207702_10063459 3300026078 Bacteria 3159
1708 Ga0207702_10113493 3300026078 Bacteria 2413
1709 Ga0207702_10170737 3300026078 Bacteria 1994
1710 Ga0207702_10297203 3300026078 Bacteria 1531
1711 Ga0207702_10819141 3300026078 Bacteria 921
1712 Ga0207702_12528685 3300026078 Bacteria 500
1713 Ga0207641_10009230 3300026088 Bacteria 8134
1714 Ga0207641_10092373 3300026088 Bacteria 2650
1715 Ga0207641_10237001 3300026088 Bacteria 1698
1716 Ga0207641_10307188 3300026088 Bacteria 1500
1717 Ga0207641_11116756 3300026088 Bacteria 787
1718 Ga0207641_11178421 3300026088 Bacteria 765
1719 Ga0207641_11833810 3300026088 Bacteria 608
1720 Ga0207648_10208985 3300026089 Bacteria 1732
1721 Ga0207648_10363711 3300026089 Bacteria 1306
1722 Ga0207648_10848325 3300026089 Bacteria 852
1723 Ga0207648_10858932 3300026089 Bacteria 846
1724 Ga0207648_11416717 3300026089 Bacteria 653
1725 Ga0207648_11485189 3300026089 Bacteria 637
1726 Ga0207648_11799558 3300026089 Bacteria 574
1727 Ga0207676_10059226 3300026095 Bacteria 3023
1728 Ga0207676_10222560 3300026095 Bacteria 1681
1729 Ga0207676_10500606 3300026095 Bacteria 1154
1730 Ga0207676_11050458 3300026095 Bacteria 804
1731 Ga0207674_10003713 3300026116 Bacteria 18642
1732 Ga0207674_10017287 3300026116 Bacteria 7869
1733 Ga0207674_10024573 3300026116 Bacteria 6435
1734 Ga0207674_10071985 3300026116 Bacteria 3473
1735 Ga0207674_10092556 3300026116 Bacteria 3012
1736 Ga0207674_10125306 3300026116 Bacteria 2535
1737 Ga0207674_10126554 3300026116 Bacteria 2521
1738 Ga0207674_10128644 3300026116 Bacteria 2497
1739 Ga0207674_10234014 3300026116 Bacteria 1785
1740 Ga0207674_10408759 3300026116 Bacteria 1312
1741 Ga0207674_10819092 3300026116 Bacteria 898
1742 Ga0207674_11165838 3300026116 Bacteria 740
1743 Ga0207674_11856537 3300026116 Unclassified 569
1744 Ga0207674_11882095 3300026116 Bacteria 565
1745 Ga0207674_11938575 3300026116 Bacteria 555
1746 Ga0207674_12284306 3300026116 Bacteria 503
1747 Ga0207675_100475143 3300026118 Bacteria 1242
1748 Ga0207675_100708954 3300026118 Bacteria 1016
1749 Ga0207675_101318555 3300026118 Bacteria 742
1750 Ga0207675_101969492 3300026118 Bacteria 602
1751 Ga0207683_10139250 3300026121 Bacteria 2186
1752 Ga0207683_10154461 3300026121 Bacteria 2072
1753 Ga0207683_10185736 3300026121 Bacteria 1886
1754 Ga0207683_10301010 3300026121 Bacteria 1467
1755 Ga0207683_10668429 3300026121 Bacteria 963
1756 Ga0207683_10757420 3300026121 Bacteria 901
1757 Ga0207698_10004871 3300026142 Bacteria 8228
1758 Ga0207698_10007267 3300026142 Bacteria 6940
1759 Ga0207698_10038635 3300026142 Bacteria 3528
1760 Ga0207698_10050100 3300026142 Bacteria 3183
1761 Ga0207698_10189246 3300026142 Bacteria 1831
1762 Ga0207698_10196978 3300026142 Bacteria 1800
1763 Ga0207698_10233124 3300026142 Bacteria 1672
1764 Ga0207698_10249127 3300026142 Bacteria 1624
1765 Ga0207698_10996304 3300026142 Bacteria 848
1766 Ga0207698_11008429 3300026142 Bacteria 843
1767 Ga0209281_1001754 3300027111 Bacteria 11084
1768 Ga0209281_1015163 3300027111 Bacteria 1613
1769 Ga0209973_1001808 3300027252 Bacteria 1916
1770 Ga0209973_1053138 3300027252 Bacteria 613
1771 Ga0209389_1000020 3300027296 Bacteria 172003
1772 Ga0209371_1000004 3300027312 Bacteria 1098197
1773 Ga0209371_1000294 3300027312 Bacteria 56307
1774 Ga0209371_1001079 3300027312 Bacteria 20371
1775 Ga0209371_1005890 3300027312 Bacteria 4714
1776 Ga0209371_1021579 3300027312 Bacteria 1557
1777 Ga0209969_1000918 3300027360 Bacteria 3988
1778 Ga0209967_1000535 3300027364 Bacteria 4994
1779 Ga0209967_1002362 3300027364 Bacteria 2443
1780 Ga0209967_1010565 3300027364 Bacteria 1288
1781 Ga0209981_1000236 3300027378 Bacteria 7112
1782 Ga0209981_1005647 3300027378 Bacteria 1664
1783 Ga0209981_1048812 3300027378 Bacteria 639
1784 Ga0209996_1000952 3300027395 Bacteria 3425
1785 Ga0209996_1005456 3300027395 Bacteria 1629
1786 Ga0209984_1000306 3300027424 Bacteria 5580
1787 Ga0209984_1001060 3300027424 Bacteria 2940
1788 Ga0209984_1061988 3300027424 Bacteria 554
1789 Ga0210000_1021598 3300027462 Bacteria 985
1790 Ga0210000_1043586 3300027462 Bacteria 714
1791 Ga0209995_1000770 3300027471 Bacteria 4923
1792 Ga0209995_1003495 3300027471 Bacteria 2502
1793 Ga0209995_1029750 3300027471 Bacteria 913
1794 Ga0209995_1042702 3300027471 Bacteria 766
1795 Ga0209968_1000211 3300027526 Bacteria 10187
1796 Ga0209968_1004689 3300027526 Bacteria 2049
1797 Ga0209968_1009239 3300027526 Bacteria 1508
1798 Ga0209968_1039003 3300027526 Bacteria 809
1799 Ga0209999_1000336 3300027543 Bacteria 7061
1800 Ga0209999_1006848 3300027543 Bacteria 2051
1801 Ga0209999_1024505 3300027543 Bacteria 1113
1802 Ga0209982_1000032 3300027552 Bacteria 12541
1803 Ga0209982_1000234 3300027552 Bacteria 6571
1804 Ga0209982_1006918 3300027552 Bacteria 1656
1805 Ga0209970_1001981 3300027614 Bacteria 3521
1806 Ga0209970_1002200 3300027614 Bacteria 3348
1807 Ga0209970_1002825 3300027614 Bacteria 2936
1808 Ga0209970_1005400 3300027614 Bacteria 2111
1809 Ga0209970_1032210 3300027614 Bacteria 913
1810 Ga0210002_1002375 3300027617 Bacteria 2717
1811 Ga0210002_1004626 3300027617 Bacteria 2055
1812 Ga0210002_1006186 3300027617 Bacteria 1803
1813 Ga0210002_1023540 3300027617 Bacteria 1002
1814 Ga0210002_1072477 3300027617 Bacteria 609
1815 Ga0209983_1000295 3300027665 Bacteria 10386
1816 Ga0209983_1000912 3300027665 Bacteria 6475
1817 Ga0209983_1038177 3300027665 Bacteria 1035
1818 Ga0209282_1009935 3300027666 Bacteria 6015
1819 Ga0209282_1011026 3300027666 Bacteria 5728
1820 Ga0209971_1000410 3300027682 Bacteria 11534
1821 Ga0209971_1029202 3300027682 Bacteria 1320
1822 Ga0209813_10204420 3300027866 Bacteria 732
1823 Ga0209813_10208851 3300027866 Bacteria 726
1824 Ga0209813_10405495 3300027866 Bacteria 550
1825 Ga0209974_10002411 3300027876 Bacteria 6776
1826 Ga0209974_10006827 3300027876 Bacteria 3961
1827 Ga0209974_10030379 3300027876 Bacteria 1791
1828 Ga0209974_10042923 3300027876 Bacteria 1506
1829 Ga0209974_10058672 3300027876 Bacteria 1301
1830 Ga0209974_10068042 3300027876 Bacteria 1212
1831 Ga0209974_10119560 3300027876 Bacteria 933
1832 Ga0209974_10229779 3300027876 Bacteria 693
1833 Ga0207428_10003152 3300027907 Bacteria 16165
1834 Ga0207428_10069564 3300027907 Bacteria 2768
1835 Ga0268266_10000021 3300028379 Bacteria 522453
1836 Ga0268266_10030836 3300028379 Bacteria 4553
1837 Ga0268266_10145338 3300028379 Bacteria 2131
1838 Ga0268266_10252838 3300028379 Bacteria 1630
1839 Ga0268266_10427091 3300028379 Bacteria 1256
1840 Ga0268266_10758477 3300028379 Bacteria 936
1841 Ga0268266_10896588 3300028379 Bacteria 857
1842 Ga0268266_11543902 3300028379 Bacteria 639
1843 Ga0268265_10053630 3300028380 Bacteria 3055
1844 Ga0268265_10346354 3300028380 Bacteria 1355
1845 Ga0268265_10826997 3300028380 Bacteria 904
1846 Ga0268264_10023204 3300028381 Bacteria 5063
1847 Ga0268264_10078261 3300028381 Bacteria 2819
1848 Ga0268264_10337557 3300028381 Bacteria 1430
1849 Ga0268264_10420078 3300028381 Bacteria 1289
1850 Ga0268264_10765519 3300028381 Bacteria 963
1851 Ga0268264_10849565 3300028381 Bacteria 914
1852 Ga0268264_12670344 3300028381 Bacteria 503
1853 Ga0265336_10092689 3300028666 Bacteria 900
1854 Ga0307517_10129027 3300028786 Bacteria 1830
1855 Ga0307517_10165527 3300028786 Bacteria 1470
1856 Ga0307515_10000861 3300028794 Bacteria 69808
1857 Ga0307515_10177587 3300028794 Bacteria 2093
1858 Ga0307515_10221417 3300028794 Bacteria 1709
1859 Ga0307515_10353691 3300028794 Bacteria 1114
1860 Ga0268256_1000005 3300030500 Bacteria 1082342
1861 Ga0268256_1000258 3300030500 Bacteria 56249
1862 Ga0268256_1000913 3300030500 Bacteria 20371
1863 Ga0268256_1005183 3300030500 Bacteria 5176
1864 Ga0268256_1034042 3300030500 Bacteria 1198
1865 Ga0307512_10114450 3300030522 Bacteria 1761
1866 Ga0316177_1000096 3300030731 Bacteria 3834
1867 Ga0316177_1071442 3300030731 Bacteria 9896
1868 Ga0316177_1205658 3300030731 Bacteria 2250
1869 Ga0316177_1209611 3300030731 Bacteria 695
1870 Ga0316176_1068400 3300030732 Bacteria 638
1871 Ga0316176_1113603 3300030732 Bacteria 1658
1872 Ga0314311_1032260 3300030733 Bacteria 8297
1873 Ga0314311_1061156 3300030733 Bacteria 5018
1874 Ga0316179_1001720 3300030734 Bacteria 618
1875 Ga0316179_1028453 3300030734 Bacteria 687
1876 Ga0316179_1058443 3300030734 Bacteria 1122
1877 Ga0316179_1068488 3300030734 Bacteria 2863
1878 Ga0316178_1000695 3300030735 Bacteria 9472
1879 Ga0316178_1033068 3300030735 Bacteria 14472
1880 Ga0316178_1135743 3300030735 Bacteria 1234
1881 Ga0316180_1091006 3300030736 Bacteria 1006
1882 Ga0316180_1139357 3300030736 Bacteria 694
1883 Ga0316183_1014056 3300030742 Bacteria 2905
1884 Ga0316183_1093519 3300030742 Bacteria 636
1885 Ga0316183_1116531 3300030742 Bacteria 2596
1886 Ga0316183_1139965 3300030742 Bacteria 4016
1887 Ga0316181_1032567 3300030744 Bacteria 2334
1888 Ga0316181_1171352 3300030744 Bacteria 2398
1889 Ga0316181_1175235 3300030744 Bacteria 2608
1890 Ga0316182_1151288 3300030745 Bacteria 2446
1891 Ga0316182_1163179 3300030745 Bacteria 1853
1892 Ga0316182_1202883 3300030745 Bacteria 1551
1893 Ga0316182_1450880 3300030745 Bacteria 800
1894 Ga0265766_1000157 3300030863 Bacteria 2484
1895 Ga0265766_1000678 3300030863 Bacteria 1516
1896 Ga0265764_100528 3300030882 Bacteria 1470
1897 Ga0265769_100077 3300030888 Bacteria 2685
1898 Ga0265761_100106 3300030889 Bacteria 2671
1899 Ga0265768_105590 3300030963 Bacteria 734
1900 Ga0265774_100665 3300031011 Bacteria 1049
1901 Ga0265330_10324192 3300031235 Bacteria 650
1902 Ga0265332_10000022 3300031238 Bacteria 213072
1903 Ga0265332_10043672 3300031238 Bacteria 1935
1904 Ga0265328_10035480 3300031239 Bacteria 1844
1905 Ga0265331_10185333 3300031250 Bacteria 939
1906 Ga0265327_10001206 3300031251 Bacteria 34837
1907 Ga0265327_10007434 3300031251 Bacteria 8453
1908 Ga0265327_10010616 3300031251 Bacteria 6447
1909 Ga0265327_10016843 3300031251 Bacteria 4618
1910 Ga0265327_10072379 3300031251 Bacteria 1721
1911 Ga0265316_10013473 3300031344 Bacteria 7260
1912 Ga0265316_10740308 3300031344 Bacteria 691
1913 Ga0307513_10082984 3300031456 Bacteria 3297
1914 Ga0307513_10154898 3300031456 Bacteria 2193
1915 Ga0307513_10155230 3300031456 Bacteria 2190
1916 Ga0307513_10277662 3300031456 Bacteria 1454
1917 Ga0307408_100028561 3300031548 Bacteria 3855
1918 Ga0307408_100131437 3300031548 Bacteria 1953
1919 Ga0307408_100186106 3300031548 Bacteria 1669
1920 Ga0307408_100188047 3300031548 Bacteria 1661
1921 Ga0307408_100202669 3300031548 Bacteria 1607
1922 Ga0307408_100209542 3300031548 Bacteria 1583
1923 Ga0307408_100304887 3300031548 Bacteria 1335
1924 Ga0307408_100435788 3300031548 Bacteria 1133
1925 Ga0307408_100850933 3300031548 Bacteria 831
1926 Ga0307408_100951099 3300031548 Bacteria 789
1927 Ga0307408_101364586 3300031548 Bacteria 666
1928 Ga0307408_101741679 3300031548 Bacteria 594
1929 Ga0307408_101783485 3300031548 Bacteria 588
1930 Ga0307508_10063395 3300031616 Bacteria 3261
1931 Ga0307508_10166732 3300031616 Bacteria 1806
1932 Ga0307514_10017304 3300031649 Bacteria 5933
1933 Ga0316575_10003487 3300031665 Bacteria 5435
1934 Ga0316575_10004197 3300031665 Bacteria 5056
1935 Ga0316575_10019997 3300031665 Bacteria 2565
1936 Ga0316575_10041167 3300031665 Bacteria 1827
1937 Ga0316575_10075551 3300031665 Bacteria 1356
1938 Ga0316575_10092362 3300031665 Bacteria 1226
1939 Ga0316575_10095476 3300031665 Bacteria 1206
1940 Ga0316575_10114305 3300031665 Bacteria 1102
1941 Ga0316575_10117423 3300031665 Bacteria 1087
1942 Ga0316575_10146133 3300031665 Bacteria 974
1943 Ga0316575_10263197 3300031665 Bacteria 725
1944 Ga0316575_10266994 3300031665 Bacteria 720
1945 Ga0316575_10461904 3300031665 Bacteria 548
1946 Ga0316575_10521875 3300031665 Bacteria 516
1947 Ga0310111_116507 3300031667 Bacteria 922
1948 Ga0316579_10000104 3300031691 Bacteria 22526
1949 Ga0316579_10001358 3300031691 Bacteria 8860
1950 Ga0316579_10003374 3300031691 Bacteria 6211
1951 Ga0316579_10003462 3300031691 Bacteria 6155
1952 Ga0316579_10021458 3300031691 Bacteria 2878
1953 Ga0316579_10028133 3300031691 Bacteria 2558
1954 Ga0316579_10039853 3300031691 Bacteria 2177
1955 Ga0316579_10044157 3300031691 Bacteria 2075
1956 Ga0316579_10067686 3300031691 Bacteria 1688
1957 Ga0316579_10092232 3300031691 Bacteria 1447
1958 Ga0316579_10097316 3300031691 Bacteria 1407
1959 Ga0316579_10234115 3300031691 Bacteria 888
1960 Ga0316579_10305886 3300031691 Bacteria 768
1961 Ga0316579_10609697 3300031691 Bacteria 528
1962 Ga0265314_10146240 3300031711 Bacteria 1455
1963 Ga0265342_10069404 3300031712 Bacteria 2058
1964 Ga0316576_10000067 3300031727 Bacteria 34602
1965 Ga0316576_10000365 3300031727 Bacteria 20446
1966 Ga0316576_10000685 3300031727 Bacteria 16585
1967 Ga0316576_10009807 3300031727 Bacteria 6198
1968 Ga0316576_10014200 3300031727 Bacteria 5317
1969 Ga0316576_10016311 3300031727 Bacteria 5012
1970 Ga0316576_10040497 3300031727 Bacteria 3349
1971 Ga0316576_10061906 3300031727 Bacteria 2743
1972 Ga0316576_10083065 3300031727 Bacteria 2379
1973 Ga0316576_10088414 3300031727 Bacteria 2306
1974 Ga0316576_10095795 3300031727 Bacteria 2214
1975 Ga0316576_10122358 3300031727 Bacteria 1955
1976 Ga0316576_10124049 3300031727 Bacteria 1940
1977 Ga0316576_10130986 3300031727 Bacteria 1887
1978 Ga0316576_10230284 3300031727 Bacteria 1393
1979 Ga0316576_10231450 3300031727 Bacteria 1389
1980 Ga0316576_10261846 3300031727 Bacteria 1297
1981 Ga0316576_10389317 3300031727 Bacteria 1034
1982 Ga0316576_10410576 3300031727 Bacteria 1003
1983 Ga0316576_10580574 3300031727 Bacteria 819
1984 Ga0316576_10594817 3300031727 Bacteria 808
1985 Ga0316576_10616186 3300031727 Bacteria 791
1986 Ga0316576_10652730 3300031727 Bacteria 765
1987 Ga0316576_10722399 3300031727 Bacteria 721
1988 Ga0316576_10879301 3300031727 Bacteria 642
1989 Ga0316576_10892595 3300031727 Bacteria 637
1990 Ga0316578_10000046 3300031728 Bacteria 25015
1991 Ga0316578_10001214 3300031728 Bacteria 10228
1992 Ga0316578_10005380 3300031728 Bacteria 6199
1993 Ga0316578_10007075 3300031728 Bacteria 5592
1994 Ga0316578_10009045 3300031728 Bacteria 5103
1995 Ga0316578_10016369 3300031728 Bacteria 4011
1996 Ga0316578_10017845 3300031728 Bacteria 3873
1997 Ga0316578_10030344 3300031728 Bacteria 3072
1998 Ga0316578_10030710 3300031728 Bacteria 3056
1999 Ga0316578_10030997 3300031728 Bacteria 3043
2000 Ga0316578_10045285 3300031728 Bacteria 2560
2001 Ga0316578_10066185 3300031728 Bacteria 2134
2002 Ga0316578_10069554 3300031728 Bacteria 2083
2003 Ga0316578_10077313 3300031728 Bacteria 1976
2004 Ga0316578_10142176 3300031728 Bacteria 1445
2005 Ga0316578_10172215 3300031728 Bacteria 1305
2006 Ga0316578_10262275 3300031728 Bacteria 1036
2007 Ga0316578_10365080 3300031728 Bacteria 858
2008 Ga0316578_10531694 3300031728 Bacteria 691
2009 Ga0316578_10926696 3300031728 Bacteria 503
2010 Ga0307516_10165682 3300031730 Bacteria 1955
2011 Ga0307516_10312302 3300031730 Bacteria 1245
2012 Ga0307405_10063128 3300031731 Bacteria 2348
2013 Ga0307405_10076672 3300031731 Bacteria 2169
2014 Ga0307405_10165128 3300031731 Bacteria 1573
2015 Ga0307405_10219242 3300031731 Bacteria 1394
2016 Ga0307405_10235077 3300031731 Bacteria 1353
2017 Ga0307405_10303349 3300031731 Bacteria 1212
2018 Ga0307405_10427199 3300031731 Bacteria 1044
2019 Ga0307405_10835403 3300031731 Bacteria 774
2020 Ga0307405_10996744 3300031731 Bacteria 714
2021 Ga0307405_11163677 3300031731 Bacteria 665
2022 Ga0307405_11390891 3300031731 Bacteria 613
2023 Ga0307405_11684182 3300031731 Bacteria 561
2024 Ga0316577_10000967 3300031733 Bacteria 12817
2025 Ga0316577_10001071 3300031733 Bacteria 12388
2026 Ga0316577_10001498 3300031733 Bacteria 11066
2027 Ga0316577_10003697 3300031733 Bacteria 7783
2028 Ga0316577_10007369 3300031733 Bacteria 5868
2029 Ga0316577_10010745 3300031733 Bacteria 4947
2030 Ga0316577_10018529 3300031733 Bacteria 3851
2031 Ga0316577_10024307 3300031733 Bacteria 3367
2032 Ga0316577_10028940 3300031733 Bacteria 3092
2033 Ga0316577_10029780 3300031733 Bacteria 3046
2034 Ga0316577_10033867 3300031733 Bacteria 2854
2035 Ga0316577_10054965 3300031733 Bacteria 2222
2036 Ga0316577_10063207 3300031733 Bacteria 2067
2037 Ga0316577_10160585 3300031733 Bacteria 1268
2038 Ga0316577_10194780 3300031733 Bacteria 1145
2039 Ga0316577_10217753 3300031733 Bacteria 1079
2040 Ga0316577_10400750 3300031733 Bacteria 779
2041 Ga0316577_10541488 3300031733 Bacteria 662
2042 Ga0316577_10827009 3300031733 Bacteria 525
2043 Ga0307413_10045052 3300031824 Bacteria 2612
2044 Ga0307413_10066958 3300031824 Bacteria 2243
2045 Ga0307413_10156171 3300031824 Bacteria 1596
2046 Ga0307413_10165604 3300031824 Bacteria 1558
2047 Ga0307413_10185992 3300031824 Bacteria 1486
2048 Ga0307413_10309588 3300031824 Bacteria 1201
2049 Ga0307413_10410818 3300031824 Bacteria 1063
2050 Ga0307413_10412499 3300031824 Bacteria 1061
2051 Ga0307413_10500660 3300031824 Bacteria 975
2052 Ga0307413_10531235 3300031824 Bacteria 950
2053 Ga0307413_10732616 3300031824 Bacteria 824
2054 Ga0307413_10909208 3300031824 Bacteria 748
2055 Ga0307413_10967460 3300031824 Bacteria 727
2056 Ga0307413_11497677 3300031824 Bacteria 596
2057 Ga0307413_11635217 3300031824 Bacteria 573
2058 Ga0307413_12050433 3300031824 Bacteria 516
2059 Ga0307410_10028499 3300031852 Bacteria 3543
2060 Ga0307410_10072063 3300031852 Bacteria 2398
2061 Ga0307410_10212029 3300031852 Bacteria 1484
2062 Ga0307410_10295603 3300031852 Bacteria 1276
2063 Ga0307410_10987284 3300031852 Bacteria 725
2064 Ga0307410_11522816 3300031852 Bacteria 589
2065 Ga0307406_10015233 3300031901 Bacteria 4444
2066 Ga0307406_10020696 3300031901 Bacteria 3879
2067 Ga0307406_10032367 3300031901 Bacteria 3192
2068 Ga0307406_10167259 3300031901 Bacteria 1587
2069 Ga0307406_10251115 3300031901 Bacteria 1332
2070 Ga0307406_11120664 3300031901 Bacteria 680
2071 Ga0307406_11221169 3300031901 Bacteria 653
2072 Ga0307406_11737647 3300031901 Bacteria 553
2073 Ga0307407_10080990 3300031903 Bacteria 1963
2074 Ga0307407_10416190 3300031903 Bacteria 968
2075 Ga0307407_10448799 3300031903 Bacteria 935
2076 Ga0307407_10910141 3300031903 Bacteria 675
2077 Ga0307412_10016334 3300031911 Bacteria 4420
2078 Ga0307412_10019091 3300031911 Bacteria 4141
2079 Ga0307412_10028293 3300031911 Bacteria 3505
2080 Ga0307412_10042944 3300031911 Bacteria 2941
2081 Ga0307412_10168217 3300031911 Bacteria 1636
2082 Ga0307412_10362043 3300031911 Bacteria 1168
2083 Ga0307412_10436612 3300031911 Bacteria 1075
2084 Ga0307412_10584276 3300031911 Bacteria 943
2085 Ga0307412_10989806 3300031911 Bacteria 742
2086 Ga0307412_10991807 3300031911 Bacteria 742
2087 Ga0307412_11382229 3300031911 Bacteria 636
2088 Ga0307412_11638315 3300031911 Bacteria 588
2089 Ga0307412_12322178 3300031911 Bacteria 501
2090 Ga0307409_100024348 3300031995 Bacteria 4220
2091 Ga0307409_100312744 3300031995 Bacteria 1466
2092 Ga0307409_100457705 3300031995 Bacteria 1233
2093 Ga0307409_100908660 3300031995 Bacteria 894
2094 Ga0307409_101509557 3300031995 Bacteria 699
2095 Ga0307409_102904690 3300031995 Bacteria 506
2096 Ga0307416_100298595 3300032002 Bacteria 1599
2097 Ga0307416_100470464 3300032002 Bacteria 1314
2098 Ga0307416_100704121 3300032002 Bacteria 1099
2099 Ga0307416_100791406 3300032002 Bacteria 1043
2100 Ga0307416_100983219 3300032002 Bacteria 946
2101 Ga0307416_101110345 3300032002 Bacteria 895
2102 Ga0307416_101166688 3300032002 Bacteria 875
2103 Ga0307416_102344064 3300032002 Bacteria 634
2104 Ga0307416_103855951 3300032002 Bacteria 502
2105 Ga0307414_10002120 3300032004 Bacteria 10346
2106 Ga0307414_10007179 3300032004 Bacteria 6251
2107 Ga0307414_10020644 3300032004 Bacteria 4110
2108 Ga0307414_10027193 3300032004 Bacteria 3693
2109 Ga0307414_10028333 3300032004 Bacteria 3631
2110 Ga0307414_10059491 3300032004 Bacteria 2698
2111 Ga0307414_10063463 3300032004 Bacteria 2625
2112 Ga0307414_10086361 3300032004 Bacteria 2314
2113 Ga0307414_10109218 3300032004 Bacteria 2100
2114 Ga0307414_10146524 3300032004 Bacteria 1856
2115 Ga0307414_10326236 3300032004 Bacteria 1308
2116 Ga0307414_10353194 3300032004 Bacteria 1262
2117 Ga0307414_10560499 3300032004 Bacteria 1019
2118 Ga0307414_10592129 3300032004 Bacteria 993
2119 Ga0307414_11041374 3300032004 Bacteria 754
2120 Ga0307414_11052334 3300032004 Bacteria 750
2121 Ga0307414_11285973 3300032004 Bacteria 678
2122 Ga0307411_10015295 3300032005 Bacteria 4303
2123 Ga0307411_10041490 3300032005 Bacteria 2928
2124 Ga0307411_10289441 3300032005 Bacteria 1308
2125 Ga0307411_10401214 3300032005 Bacteria 1133
2126 Ga0307411_10461159 3300032005 Bacteria 1065
2127 Ga0307411_10568798 3300032005 Bacteria 970
2128 Ga0307411_10649612 3300032005 Bacteria 913
2129 Ga0307411_10841422 3300032005 Bacteria 811
2130 Ga0307411_11179440 3300032005 Bacteria 693
2131 Ga0307415_100095911 3300032126 Bacteria 2160
2132 Ga0307415_100151338 3300032126 Bacteria 1786
2133 Ga0307415_100468566 3300032126 Bacteria 1093
2134 Ga0307415_101209228 3300032126 Bacteria 712
2135 Ga0316583_10013246 3300032133 Bacteria 2976
2136 Ga0316583_10016452 3300032133 Bacteria 2662
2137 Ga0316583_10027138 3300032133 Bacteria 2044
2138 Ga0316583_10028287 3300032133 Bacteria 1999
2139 Ga0316583_10029366 3300032133 Bacteria 1960
2140 Ga0316583_10038919 3300032133 Bacteria 1684
2141 Ga0316583_10134631 3300032133 Bacteria 861
2142 Ga0316583_10148963 3300032133 Bacteria 815
2143 Ga0316585_10000029 3300032137 Bacteria 21513
2144 Ga0316585_10004403 3300032137 Bacteria 3919
2145 Ga0316585_10005145 3300032137 Bacteria 3682
2146 Ga0316585_10009602 3300032137 Bacteria 2829
2147 Ga0316585_10010564 3300032137 Bacteria 2711
2148 Ga0316585_10064197 3300032137 Bacteria 1188
2149 Ga0316585_10075624 3300032137 Bacteria 1095
2150 Ga0316585_10117149 3300032137 Bacteria 876
2151 Ga0316585_10117714 3300032137 Bacteria 874
2152 Ga0316580_10000016 3300032139 Bacteria 26098
2153 Ga0316580_10000485 3300032139 Bacteria 9163
2154 Ga0316580_10002303 3300032139 Bacteria 5235
2155 Ga0316580_10006329 3300032139 Bacteria 3494
2156 Ga0316580_10006854 3300032139 Bacteria 3374
2157 Ga0316580_10011624 3300032139 Bacteria 2675
2158 Ga0316580_10031862 3300032139 Bacteria 1632
2159 Ga0316580_10083950 3300032139 Bacteria 974
2160 Ga0316580_10159700 3300032139 Bacteria 692
2161 Ga0316580_10176469 3300032139 Bacteria 657
2162 Ga0316580_10190930 3300032139 Bacteria 631
2163 Ga0316580_10200069 3300032139 Bacteria 615
2164 Ga0316580_10246234 3300032139 Bacteria 552
2165 Ga0316593_10000027 3300032168 Bacteria 15426
2166 Ga0316593_10000032 3300032168 Bacteria 14610
2167 Ga0316593_10000037 3300032168 Bacteria 14308
2168 Ga0316593_10000041 3300032168 Bacteria 14110
2169 Ga0316593_10000049 3300032168 Bacteria 13299
2170 Ga0316593_10000058 3300032168 Bacteria 12691
2171 Ga0316593_10000096 3300032168 Bacteria 11298
2172 Ga0316593_10000111 3300032168 Bacteria 10694
2173 Ga0316593_10000167 3300032168 Bacteria 9674
2174 Ga0316593_10000257 3300032168 Bacteria 8797
2175 Ga0316593_10000267 3300032168 Bacteria 8686
2176 Ga0316593_10000387 3300032168 Bacteria 7860
2177 Ga0316593_10000520 3300032168 Bacteria 7142
2178 Ga0316593_10001014 3300032168 Bacteria 5811
2179 Ga0316593_10001038 3300032168 Bacteria 5773
2180 Ga0316593_10001228 3300032168 Bacteria 5525
2181 Ga0316593_10001237 3300032168 Bacteria 5509
2182 Ga0316593_10001676 3300032168 Bacteria 4993
2183 Ga0316593_10001882 3300032168 Bacteria 4802
2184 Ga0316593_10001960 3300032168 Bacteria 4732
2185 Ga0316593_10002148 3300032168 Bacteria 4599
2186 Ga0316593_10002176 3300032168 Bacteria 4576
2187 Ga0316593_10002233 3300032168 Bacteria 4536
2188 Ga0316593_10002520 3300032168 Bacteria 4368
2189 Ga0316593_10003055 3300032168 Bacteria 4085
2190 Ga0316593_10003521 3300032168 Bacteria 3902
2191 Ga0316593_10004311 3300032168 Bacteria 3640
2192 Ga0316593_10004408 3300032168 Bacteria 3612
2193 Ga0316593_10004886 3300032168 Bacteria 3485
2194 Ga0316593_10005171 3300032168 Bacteria 3419
2195 Ga0316593_10005293 3300032168 Bacteria 3388
2196 Ga0316593_10005446 3300032168 Bacteria 3358
2197 Ga0316593_10005483 3300032168 Bacteria 3351
2198 Ga0316593_10007086 3300032168 Bacteria 3062
2199 Ga0316593_10007176 3300032168 Bacteria 3051
2200 Ga0316593_10007312 3300032168 Bacteria 3027
2201 Ga0316593_10010076 3300032168 Bacteria 2696
2202 Ga0316593_10011741 3300032168 Bacteria 2555
2203 Ga0316593_10013327 3300032168 Bacteria 2432
2204 Ga0316593_10017987 3300032168 Bacteria 2165
2205 Ga0316593_10020625 3300032168 Bacteria 2051
2206 Ga0316593_10023756 3300032168 Bacteria 1938
2207 Ga0316593_10026445 3300032168 Bacteria 1855
2208 Ga0316593_10029669 3300032168 Bacteria 1771
2209 Ga0316593_10047085 3300032168 Bacteria 1449
2210 Ga0316593_10057979 3300032168 Bacteria 1320
2211 Ga0316593_10062678 3300032168 Bacteria 1274
2212 Ga0316593_10065593 3300032168 Bacteria 1248
2213 Ga0316593_10080966 3300032168 Bacteria 1133
2214 Ga0316593_10083019 3300032168 Bacteria 1120
2215 Ga0316593_10113106 3300032168 Bacteria 970
2216 Ga0316593_10126504 3300032168 Bacteria 920
2217 Ga0316593_10129929 3300032168 Bacteria 908
2218 Ga0316593_10135569 3300032168 Bacteria 890
2219 Ga0316593_10143934 3300032168 Bacteria 864
2220 Ga0316593_10144186 3300032168 Bacteria 864
2221 Ga0316593_10195227 3300032168 Bacteria 747
2222 Ga0316593_10209127 3300032168 Bacteria 723
2223 Ga0316593_10229398 3300032168 Bacteria 691
2224 Ga0316593_10249181 3300032168 Bacteria 664
2225 Ga0316593_10257614 3300032168 Bacteria 654
2226 Ga0316593_10258063 3300032168 Bacteria 653
2227 Ga0316593_10288698 3300032168 Bacteria 619
2228 Ga0307507_10073024 3300033179 Bacteria 3087
2229 Ga0307510_10002916 3300033180 Bacteria 19686
2230 Ga0316592_1000006 3300033524 Bacteria 14706
2231 Ga0316592_1000009 3300033524 Bacteria 13765
2232 Ga0316592_1000041 3300033524 Bacteria 10240
2233 Ga0316592_1000052 3300033524 Bacteria 9955
2234 Ga0316592_1000138 3300033524 Bacteria 8013
2235 Ga0316592_1000456 3300033524 Bacteria 5618
2236 Ga0316592_1000807 3300033524 Bacteria 4683
2237 Ga0316592_1001541 3300033524 Bacteria 3743
2238 Ga0316592_1001866 3300033524 Bacteria 3524
2239 Ga0316592_1004425 3300033524 Bacteria 2611
2240 Ga0316592_1004470 3300033524 Bacteria 2600
2241 Ga0316592_1018516 3300033524 Bacteria 1467
2242 Ga0316592_1026467 3300033524 Bacteria 1252
2243 Ga0316592_1027376 3300033524 Bacteria 1233
2244 Ga0316592_1033953 3300033524 Bacteria 1116
2245 Ga0316592_1038710 3300033524 Bacteria 1052
2246 Ga0316592_1040253 3300033524 Bacteria 1033
2247 Ga0316592_1057054 3300033524 Bacteria 875
2248 Ga0316592_1061224 3300033524 Bacteria 845
2249 Ga0316592_1061334 3300033524 Bacteria 845
2250 Ga0316592_1086705 3300033524 Bacteria 714
2251 Ga0316592_1137312 3300033524 Bacteria 573
2252 Ga0316592_1176847 3300033524 Bacteria 509
2253 Ga0316586_1000002 3300033527 Bacteria 13323
2254 Ga0316586_1000040 3300033527 Bacteria 8841
2255 Ga0316586_1000064 3300033527 Bacteria 7843
2256 Ga0316586_1000155 3300033527 Bacteria 5568
2257 Ga0316586_1000232 3300033527 Bacteria 4822
2258 Ga0316586_1000399 3300033527 Bacteria 4139
2259 Ga0316586_1000417 3300033527 Bacteria 4081
2260 Ga0316586_1000436 3300033527 Bacteria 4029
2261 Ga0316586_1000578 3300033527 Bacteria 3628
2262 Ga0316586_1000621 3300033527 Bacteria 3531
2263 Ga0316586_1001553 3300033527 Bacteria 2671
2264 Ga0316586_1004330 3300033527 Bacteria 1930
2265 Ga0316586_1014251 3300033527 Bacteria 1254
2266 Ga0316586_1023229 3300033527 Bacteria 1035
2267 Ga0316586_1040446 3300033527 Bacteria 818
2268 Ga0316586_1041976 3300033527 Bacteria 806
2269 Ga0316586_1047246 3300033527 Bacteria 766
2270 Ga0316586_1051546 3300033527 Bacteria 737
2271 Ga0316586_1052014 3300033527 Bacteria 734
2272 Ga0316586_1079238 3300033527 Bacteria 612
2273 Ga0316586_1084892 3300033527 Bacteria 594
2274 Ga0316586_1089341 3300033527 Bacteria 581
2275 Ga0316586_1118603 3300033527 Bacteria 515
2276 Ga0316588_1000073 3300033528 Bacteria 8863
2277 Ga0316588_1000195 3300033528 Bacteria 6976
2278 Ga0316588_1000300 3300033528 Bacteria 6185
2279 Ga0316588_1000439 3300033528 Bacteria 5571
2280 Ga0316588_1000676 3300033528 Bacteria 4972
2281 Ga0316588_1001236 3300033528 Bacteria 4108
2282 Ga0316588_1002450 3300033528 Bacteria 3237
2283 Ga0316588_1003121 3300033528 Bacteria 2980
2284 Ga0316588_1005516 3300033528 Bacteria 2468
2285 Ga0316588_1005517 3300033528 Bacteria 2468
2286 Ga0316588_1020411 3300033528 Bacteria 1500
2287 Ga0316588_1030488 3300033528 Bacteria 1264
2288 Ga0316588_1065949 3300033528 Bacteria 886
2289 Ga0316588_1089840 3300033528 Bacteria 765
2290 Ga0316588_1095479 3300033528 Bacteria 742
2291 Ga0316588_1097995 3300033528 Bacteria 733
2292 Ga0316588_1101879 3300033528 Bacteria 719
2293 Ga0316588_1107268 3300033528 Bacteria 702
2294 Ga0316588_1111935 3300033528 Bacteria 687
2295 Ga0316588_1121624 3300033528 Bacteria 661
2296 Ga0316588_1126595 3300033528 Bacteria 648
2297 Ga0316588_1148550 3300033528 Bacteria 601
2298 Ga0316587_1000021 3300033529 Bacteria 9386
2299 Ga0316587_1000243 3300033529 Bacteria 4897
2300 Ga0316587_1000351 3300033529 Bacteria 4391
2301 Ga0316587_1000443 3300033529 Bacteria 4127
2302 Ga0316587_1000518 3300033529 Bacteria 3971
2303 Ga0316587_1000623 3300033529 Bacteria 3760
2304 Ga0316587_1000711 3300033529 Bacteria 3610
2305 Ga0316587_1002605 3300033529 Bacteria 2429
2306 Ga0316587_1004402 3300033529 Bacteria 2050
2307 Ga0316587_1008267 3300033529 Bacteria 1632
2308 Ga0316587_1009371 3300033529 Bacteria 1552
2309 Ga0316587_1010453 3300033529 Bacteria 1485
2310 Ga0316587_1013103 3300033529 Bacteria 1354
2311 Ga0316587_1013771 3300033529 Bacteria 1329
2312 Ga0316587_1019590 3300033529 Bacteria 1145
2313 Ga0316587_1033219 3300033529 Bacteria 917
2314 Ga0316587_1033742 3300033529 Bacteria 911
2315 Ga0316587_1035170 3300033529 Bacteria 895
2316 Ga0316587_1041422 3300033529 Bacteria 832
2317 Ga0316587_1044604 3300033529 Bacteria 805
2318 Ga0316587_1045255 3300033529 Bacteria 799
2319 Ga0316587_1064554 3300033529 Bacteria 681
2320 Ga0316587_1076232 3300033529 Bacteria 631
2321 Ga0316587_1092801 3300033529 Bacteria 577
2322 Ga0316587_1116010 3300033529 Bacteria 522
2323 Ga0316587_1125893 3300033529 Bacteria 504
2324 Ga0316596_1000014 3300033541 Bacteria 16366
2325 Ga0316596_1000016 3300033541 Bacteria 15149
2326 Ga0316596_1000017 3300033541 Bacteria 15063
2327 Ga0316596_1000037 3300033541 Bacteria 13851
2328 Ga0316596_1000038 3300033541 Bacteria 13809
2329 Ga0316596_1000040 3300033541 Bacteria 13770
2330 Ga0316596_1000061 3300033541 Bacteria 12225
2331 Ga0316596_1000073 3300033541 Bacteria 11690
2332 Ga0316596_1000123 3300033541 Bacteria 10193
2333 Ga0316596_1000222 3300033541 Bacteria 8568
2334 Ga0316596_1000323 3300033541 Bacteria 7744
2335 Ga0316596_1000395 3300033541 Bacteria 7244
2336 Ga0316596_1000524 3300033541 Bacteria 6575
2337 Ga0316596_1000650 3300033541 Bacteria 6228
2338 Ga0316596_1000651 3300033541 Bacteria 6226
2339 Ga0316596_1000749 3300033541 Bacteria 5929
2340 Ga0316596_1000864 3300033541 Bacteria 5686
2341 Ga0316596_1000880 3300033541 Bacteria 5653
2342 Ga0316596_1001024 3300033541 Bacteria 5392
2343 Ga0316596_1001420 3300033541 Bacteria 4821
2344 Ga0316596_1001893 3300033541 Bacteria 4375
2345 Ga0316596_1002164 3300033541 Bacteria 4160
2346 Ga0316596_1002714 3300033541 Bacteria 3807
2347 Ga0316596_1002852 3300033541 Bacteria 3738
2348 Ga0316596_1002901 3300033541 Bacteria 3711
2349 Ga0316596_1003697 3300033541 Bacteria 3378
2350 Ga0316596_1008032 3300033541 Bacteria 2504
2351 Ga0316596_1008327 3300033541 Bacteria 2468
2352 Ga0316596_1008767 3300033541 Bacteria 2417
2353 Ga0316596_1009728 3300033541 Bacteria 2311
2354 Ga0316596_1010835 3300033541 Bacteria 2216
2355 Ga0316596_1011433 3300033541 Bacteria 2169
2356 Ga0316596_1012776 3300033541 Bacteria 2068
2357 Ga0316596_1020888 3300033541 Bacteria 1667
2358 Ga0316596_1026342 3300033541 Bacteria 1499
2359 Ga0316596_1030126 3300033541 Bacteria 1406
2360 Ga0316596_1037663 3300033541 Bacteria 1266
2361 Ga0316596_1037782 3300033541 Bacteria 1264
2362 Ga0316596_1053674 3300033541 Bacteria 1069
2363 Ga0316596_1063707 3300033541 Bacteria 984
2364 Ga0316596_1063753 3300033541 Bacteria 984
2365 Ga0316596_1070662 3300033541 Bacteria 934
2366 Ga0316596_1074731 3300033541 Bacteria 908
2367 Ga0316596_1094542 3300033541 Bacteria 806
2368 Ga0316596_1103989 3300033541 Bacteria 769
2369 Ga0316596_1157555 3300033541 Bacteria 625
2370 Ga0373930_0022042 3300034816 Bacteria 1257
2371 Ga0373950_0057916 3300034818 Bacteria 773
2372 Ga0373944_0368475 3300035089 Bacteria 549
2373 Ga0373949_0263731 3300035090 Bacteria 536
2374 Ga0373951_0000260 3300035091 Bacteria 17321
2375 Ga0373952_0261732 3300035092 Bacteria 527
2376 Ga0373939_0510329 3300035114 Bacteria 515
2377 Ga0373945_0201240 3300035116 Bacteria 827
2378 Ga0373945_0225258 3300035116 Bacteria 785
2379 Ga0373957_0319839 3300035120 Bacteria 660
2380 Ga0373960_0313808 3300035121 Bacteria 586
2381 Ga0373946_0301519 3300035171 Bacteria 792
2382 Ga0373961_0154758 3300035241 Bacteria 784
2383 Ga0373961_0366988 3300035241 Bacteria 546
2384 Ga0373962_0045106 3300035242 Bacteria 1255
2385 Ga0373962_0131132 3300035242 Bacteria 807
2386 Ga0316574_0001182 3300035398 Bacteria 12095
2387 Ga0316574_0001517 3300035398 Bacteria 11056
2388 Ga0316574_0004866 3300035398 Bacteria 7113
2389 Ga0316574_0005225 3300035398 Bacteria 6904
2390 Ga0316574_0006168 3300035398 Bacteria 6457
2391 Ga0316574_0007928 3300035398 Bacteria 5862
2392 Ga0316574_0010022 3300035398 Bacteria 5331
2393 Ga0316574_0018187 3300035398 Bacteria 4126
2394 Ga0316574_0018286 3300035398 Bacteria 4116
2395 Ga0316574_0019286 3300035398 Bacteria 4020
2396 Ga0316574_0033688 3300035398 Bacteria 3118
2397 Ga0316574_0083922 3300035398 Bacteria 2026
2398 Ga0316574_0121691 3300035398 Bacteria 1676
2399 Ga0316574_0131023 3300035398 Bacteria 1613
2400 Ga0316574_0152524 3300035398 Bacteria 1489
2401 Ga0316574_0263585 3300035398 Bacteria 1100
2402 Ga0316574_0456229 3300035398 Bacteria 800
2403 Ga0316574_0654876 3300035398 Bacteria 646
2404 Ga0316574_0668900 3300035398 Unclassified 638
2405 Ga0316574_0737311 3300035398 Bacteria 602
2406 Ga0316574_0929972 3300035398 Bacteria 525
2407 Ga0373931_0100547 3300035691 Bacteria 1626
2408 Ga0373931_0476336 3300035691 Bacteria 802
2409 Ga0373927_0042975 3300035695 Bacteria 2928
2410 Ga0373927_0361310 3300035695 Bacteria 957
2411 Ga0373927_0658028 3300035695 Bacteria 692
2412 Ga0373937_0308694 3300036401 Bacteria 1496
2413 Ga0373937_0481457 3300036401 Bacteria 1179
2414 Ga0373937_1281920 3300036401 Bacteria 681
2415 Ga0310112_000276 3300036458 Bacteria 4093
2416 Ga0310109_032224 3300036534 Bacteria 692
2417 Ga0310110_006942 3300036535 Bacteria 1654
2418 Ga0316582_0000535 3300036647 Bacteria 14503
2419 Ga0316582_0001466 3300036647 Bacteria 10378
2420 Ga0316582_0004346 3300036647 Bacteria 7138
2421 Ga0316582_0006754 3300036647 Bacteria 6057
2422 Ga0316582_0016951 3300036647 Bacteria 4202
2423 Ga0316582_0019628 3300036647 Bacteria 3961
2424 Ga0316582_0024855 3300036647 Bacteria 3590
2425 Ga0316582_0034174 3300036647 Bacteria 3129
2426 Ga0316582_0054137 3300036647 Bacteria 2553
2427 Ga0316582_0073333 3300036647 Bacteria 2221
2428 Ga0316582_0076209 3300036647 Bacteria 2180
2429 Ga0316582_0077411 3300036647 Bacteria 2164
2430 Ga0316582_0118243 3300036647 Bacteria 1771
2431 Ga0316582_0165274 3300036647 Bacteria 1500
2432 Ga0316582_0216723 3300036647 Bacteria 1308
2433 Ga0316582_0260869 3300036647 Bacteria 1188
2434 Ga0316582_0277956 3300036647 Bacteria 1149
2435 Ga0316582_0300986 3300036647 Bacteria 1102
2436 Ga0316582_0322039 3300036647 Bacteria 1063
2437 Ga0316582_0750522 3300036647 Bacteria 669
2438 Ga0316584_0000609 3300036712 Bacteria 19432
2439 Ga0316584_0002043 3300036712 Bacteria 12624
2440 Ga0316584_0004211 3300036712 Bacteria 9495
2441 Ga0316584_0004833 3300036712 Bacteria 8958
2442 Ga0316584_0004999 3300036712 Bacteria 8833
2443 Ga0316584_0015064 3300036712 Bacteria 5524
2444 Ga0316584_0018774 3300036712 Bacteria 4991
2445 Ga0316584_0023344 3300036712 Bacteria 4519
2446 Ga0316584_0032167 3300036712 Bacteria 3881
2447 Ga0316584_0043243 3300036712 Bacteria 3359
2448 Ga0316584_0046768 3300036712 Bacteria 3232
2449 Ga0316584_0071766 3300036712 Bacteria 2594
2450 Ga0316584_0116154 3300036712 Bacteria 2002
2451 Ga0316584_0124219 3300036712 Bacteria 1928
2452 Ga0316584_0133805 3300036712 Bacteria 1851
2453 Ga0316584_0259057 3300036712 Bacteria 1269
2454 Ga0316584_0272749 3300036712 Bacteria 1231
2455 Ga0316584_0278893 3300036712 Bacteria 1215
2456 Ga0316584_0286693 3300036712 Bacteria 1195
2457 Ga0316584_0362623 3300036712 Bacteria 1038
2458 Ga0316584_0370650 3300036712 Bacteria 1025
2459 Ga0316584_0533874 3300036712 Bacteria 821
2460 Ga0316584_0749515 3300036712 Bacteria 666
2461 Ga0316584_0806644 3300036712 Bacteria 637
2462 Ga0316584_0876177 3300036712 Bacteria 606
2463 Ga0395899_0001959 3300037312 Bacteria 16927
2464 Ga0395899_0012521 3300037312 Bacteria 6499
2465 Ga0395899_0022053 3300037312 Bacteria 4829
2466 Ga0395899_0042216 3300037312 Bacteria 3405
2467 Ga0395899_0053921 3300037312 Bacteria 2976
2468 Ga0395899_0093693 3300037312 Bacteria 2174
2469 Ga0395899_0110574 3300037312 Bacteria 1976
2470 Ga0395899_0202934 3300037312 Bacteria 1381
2471 Ga0395900_0000012 3300037418 Bacteria 401198
2472 Ga0395900_0000374 3300037418 Bacteria 64539
2473 Ga0395900_0036642 3300037418 Bacteria 5057
2474 Ga0395900_0037703 3300037418 Bacteria 4983
2475 Ga0395900_0127994 3300037418 Bacteria 2603
2476 Ga0395900_0569240 3300037418 Bacteria 1076
2477 Ga0395900_0729578 3300037418 Bacteria 922
2478 Ga0395898_0000558 3300037466 Bacteria 69802
2479 Ga0395898_0000600 3300037466 Bacteria 66858
2480 Ga0395898_0006608 3300037466 Bacteria 12359
2481 Ga0395898_0044031 3300037466 Bacteria 4396
2482 Ga0395898_0045474 3300037466 Bacteria 4315
2483 Ga0395898_0199925 3300037466 Bacteria 1908
2484 Ga0395898_0254868 3300037466 Bacteria 1673
2485 Ga0395898_0519383 3300037466 Bacteria 1132
2486 Ga0395905_0029112 3300037471 Bacteria 5205
2487 Ga0395905_0110422 3300037471 Bacteria 2582
2488 Ga0395905_0373903 3300037471 Bacteria 1318
2489 Ga0395905_0474148 3300037471 Bacteria 1151
2490 Ga0395905_0575649 3300037471 Bacteria 1027
2491 Ga0395905_1025237 3300037471 Bacteria 728
2492 Ga0316581_0001208 3300037588 Bacteria 5686
2493 Ga0316581_0005787 3300037588 Bacteria 3243
2494 Ga0316581_0009007 3300037588 Bacteria 2732
2495 Ga0316581_0010269 3300037588 Bacteria 2592
2496 Ga0316581_0039938 3300037588 Bacteria 1428
2497 Ga0316581_0046234 3300037588 Bacteria 1330
2498 Ga0395901_0002939 3300038443 Bacteria 17197
2499 Ga0395901_0011584 3300038443 Bacteria 8935
2500 Ga0395901_0075079 3300038443 Bacteria 3526
2501 Ga0395901_0124834 3300038443 Bacteria 2704
2502 Ga0395901_0134155 3300038443 Bacteria 2602
2503 Ga0395901_0227626 3300038443 Bacteria 1947
2504 Ga0395901_0276971 3300038443 Bacteria 1744
2505 Ga0395901_0296585 3300038443 Bacteria 1676
2506 Ga0395901_0386130 3300038443 Bacteria 1440
2507 Ga0395901_0636669 3300038443 Bacteria 1071
2508 Ga0395901_1062292 3300038443 Bacteria 782
2509 Ga0237819_00026 3300038705 Bacteria 50539
2510 Ga0237819_04573 3300038705 Bacteria 2261
2511 Ga0237819_04725 3300038705 Bacteria 2209
2512 Ga0400484_20003 3300038725 Bacteria 3915
2513 Ga0400490_04947 3300038726 Unclassified 2566
2514 Ga0400490_39901 3300038726 Bacteria 15663
2515 Ga0400491_25146 3300038727 Bacteria 1988
2516 Ga0400491_26818 3300038727 Bacteria 4104
2517 Ga0400485_07280 3300038735 Bacteria 1812
2518 Ga0400488_55051 3300038741 Bacteria 2629
2519 Ga0400486_26826 3300038742 Bacteria 2102
2520 Ga0400486_33075 3300038742 Bacteria 8482
2521 Ga0400483_016430 3300039062 Bacteria 1395
2522 Ga0400483_053664 3300039062 Bacteria 1717
2523 Ga0400483_140144 3300039062 Bacteria 16717
2524 Ga0400483_140808 3300039062 Bacteria 1967
2525 Ga0400483_211411 3300039062 Bacteria 9795
2526 Ga0400483_248744 3300039062 Bacteria 4547
2527 Ga0400483_251558 3300039062 Bacteria 1588
2528 Ga0400483_287520 3300039062 Bacteria 1376
2529 Ga0400489_34148 3300039093 Bacteria 5617
2530 Ga0400487_01073 3300039110 Bacteria 19698
2531 Ga0400487_09422 3300039110 Bacteria 1734
2532 Ga0400487_29008 3300039110 Bacteria 14273
2533 Ga0400487_39640 3300039110 Bacteria 4477
2534 Ga0400487_43302 3300039110 Bacteria 1074
2535 Ga0237816_00020 3300039145 Bacteria 9419
2536 Ga0436365_0377119 3300039437 Bacteria 1192
2537 Ga0436361_0384522 3300039447 Bacteria 15319
2538 Ga0436361_0507941 3300039447 Bacteria 857
2539 Ga0436363_0406138 3300039450 Bacteria 515
2540 Ga0439436_0000027 3300041404 Bacteria 53417
2541 Ga0439436_0009292 3300041404 Bacteria 3013
2542 Ga0439436_0026400 3300041404 Bacteria 1703
2543 Ga0439436_0059936 3300041404 Bacteria 1066
2544 Ga0439436_0089255 3300041404 Bacteria 858
2545 Ga0439436_0096711 3300041404 Bacteria 822
2546 Ga0439436_0154070 3300041404 Bacteria 649
2547 Ga0439438_039648 3300041405 Bacteria 1226
2548 Ga0439439_0114724 3300041406 Bacteria 748
2549 Ga0439447_101148 3300041407 Bacteria 661
2550 Ga0439453_0041429 3300041408 Bacteria 904
2551 Ga0439461_0169640 3300041410 Bacteria 573
2552 Ga0439466_0168262 3300041411 Bacteria 669
2553 Ga0439466_0221034 3300041411 Bacteria 575
2554 Ga0439465_0000141 3300041413 Bacteria 17802
2555 Ga0439465_0005524 3300041413 Bacteria 4031
2556 Ga0439465_0009954 3300041413 Bacteria 2993
2557 Ga0439465_0048750 3300041413 Bacteria 1382
2558 Ga0439465_0085583 3300041413 Bacteria 1073
2559 Ga0439465_0146895 3300041413 Bacteria 840
2560 Ga0439465_0435531 3300041413 Bacteria 502
2561 Ga0451787_090900 3300041441 Bacteria 1693
2562 Ga0451787_099851 3300041441 Bacteria 584
2563 Ga0451787_174747 3300041441 Bacteria 1119
2564 Ga0451787_614450 3300041441 Bacteria 1224
2565 Ga0451788_07268 3300041442 Bacteria 847
2566 Ga0451788_12893 3300041442 Bacteria 626
2567 Ga0451789_0496166 3300041443 Bacteria 1122
2568 Ga0451789_0621874 3300041443 Bacteria 1419
2569 Ga0451789_0635352 3300041443 Bacteria 1382
2570 Ga0451789_1326297 3300041443 Bacteria 760
2571 Ga0451790_27784 3300041444 Bacteria 956
2572 Ga0451790_34245 3300041444 Bacteria 806
2573 Ga0451792_22477 3300041445 Bacteria 554
2574 Ga0451794_05677 3300041446 Bacteria 534
2575 Ga0451794_07771 3300041446 Bacteria 1130
2576 Ga0451794_16517 3300041446 Bacteria 728
2577 Ga0451794_25160 3300041446 Bacteria 1406
2578 Ga0451794_26325 3300041446 Bacteria 501
2579 Ga0451791_0166944 3300041451 Bacteria 1442
2580 Ga0451791_1075929 3300041451 Bacteria 2186
2581 Ga0451791_1149941 3300041451 Bacteria 1560
2582 Ga0451791_1657178 3300041451 Bacteria 1141
2583 Ga0451793_0393032 3300041452 Bacteria 3643
2584 Ga0451793_1182750 3300041452 Bacteria 1324
2585 Ga0451793_1591094 3300041452 Bacteria 3706
2586 Ga0451793_1717091 3300041452 Bacteria 776
2587 Ga0451797_0821370 3300041453 Bacteria 979
2588 Ga0451797_1067951 3300041453 Bacteria 637
2589 Ga0451797_1216789 3300041453 Bacteria 1090
2590 Ga0451797_1510718 3300041453 Bacteria 1180
2591 Ga0451797_1538150 3300041453 Bacteria 2417
2592 Ga0451799_33594 3300041454 Bacteria 1149
2593 Ga0451801_12272 3300041455 Bacteria 940
2594 Ga0451801_29483 3300041455 Bacteria 726
2595 Ga0451801_38637 3300041455 Bacteria 1794
2596 Ga0451795_0084050 3300041456 Bacteria 1038
2597 Ga0451795_0151863 3300041456 Bacteria 948
2598 Ga0451795_0342613 3300041456 Bacteria 718
2599 Ga0451795_0578639 3300041456 Bacteria 1137
2600 Ga0451795_1021322 3300041456 Bacteria 718
2601 Ga0451803_13016 3300041457 Bacteria 830
2602 Ga0451803_13132 3300041457 Bacteria 570
2603 Ga0451803_13289 3300041457 Bacteria 548
2604 Ga0451798_0397162 3300041458 Bacteria 1168
2605 Ga0451798_1044063 3300041458 Bacteria 1699
2606 Ga0451800_0287125 3300041459 Bacteria 951
2607 Ga0451800_0307366 3300041459 Bacteria 586
2608 Ga0451800_0592375 3300041459 Bacteria 682
2609 Ga0451800_0640459 3300041459 Bacteria 1010
2610 Ga0451800_1057945 3300041459 Bacteria 15810
2611 Ga0451800_1451982 3300041459 Bacteria 565
2612 Ga0451802_0263205 3300041460 Bacteria 688
2613 Ga0451802_0439083 3300041460 Bacteria 894
2614 Ga0451802_1084816 3300041460 Bacteria 1125
2615 Ga0451802_1642252 3300041460 Bacteria 759
2616 Ga0451805_023811 3300041461 Bacteria 902
2617 Ga0451805_031316 3300041461 Bacteria 510
2618 Ga0451806_234332 3300041462 Bacteria 19745
2619 Ga0451804_0490230 3300041463 Bacteria 812
2620 Ga0451804_0524950 3300041463 Bacteria 2306
2621 Ga0451804_0794743 3300041463 Bacteria 944
2622 Ga0451804_1138845 3300041463 Bacteria 2046
2623 Ga0451808_08268 3300041464 Bacteria 1047
2624 Ga0451808_22102 3300041464 Bacteria 1018
2625 Ga0451808_34934 3300041464 Bacteria 1888
2626 Ga0451807_0782054 3300041486 Bacteria 586
2627 Ga0451807_1035554 3300041486 Bacteria 6707
2628 Ga0451807_1060494 3300041486 Bacteria 713
2629 Ga0451807_1140072 3300041486 Bacteria 544
2630 Ga0451807_1146074 3300041486 Bacteria 568
2631 Ga0451807_1465899 3300041486 Bacteria 1044
2632 Ga0451807_1466121 3300041486 Bacteria 990
2633 Ga0451833_0905101 3300041491 Bacteria 1354
2634 Ga0451835_0969709 3300041492 Bacteria 608
2635 Ga0451837_0263471 3300041494 Bacteria 511
2636 Ga0451837_1328347 3300041494 Bacteria 1319
2637 Ga0451837_1382188 3300041494 Bacteria 1661
2638 Ga0451837_1590620 3300041494 Bacteria 1840
2639 Ga0451837_1810154 3300041494 Bacteria 505
2640 Ga0451839_0840225 3300041496 Bacteria 1129
2641 Ga0451839_0845113 3300041496 Bacteria 1088
2642 Ga0451840_04070 3300041497 Bacteria 628
2643 Ga0451841_0213104 3300041498 Bacteria 597
2644 Ga0451841_0393778 3300041498 Bacteria 1005
2645 Ga0451841_1160806 3300041498 Bacteria 1817
2646 Ga0451845_0463465 3300041501 Bacteria 638
2647 Ga0451845_0895488 3300041501 Bacteria 952
2648 Ga0451846_15792 3300041502 Bacteria 1233
2649 Ga0451846_59778 3300041502 Bacteria 780
2650 Ga0451847_0253243 3300041503 Bacteria 1326
2651 Ga0451847_0405980 3300041503 Bacteria 518
2652 Ga0451849_0324159 3300041505 Bacteria 573
2653 Ga0451850_11081 3300041506 Bacteria 1054
2654 Ga0451851_0409079 3300041507 Bacteria 1191
2655 Ga0451851_0574573 3300041507 Bacteria 1309
2656 Ga0451843_0252808 3300041509 Bacteria 1055
2657 Ga0451843_0573241 3300041509 Bacteria 1631
2658 Ga0451843_0577312 3300041509 Bacteria 999
2659 Ga0451843_0608229 3300041509 Bacteria 2755
2660 Ga0451843_1183522 3300041509 Bacteria 711
2661 Ga0451843_1351875 3300041509 Bacteria 655
2662 Ga0451843_1466142 3300041509 Bacteria 1480
2663 Ga0451855_0479571 3300041511 Bacteria 1001
2664 Ga0451855_0587073 3300041511 Bacteria 783
2665 Ga0451855_1747366 3300041511 Bacteria 1219
2666 Ga0451853_1032146 3300041512 Bacteria 1158
2667 Ga0451853_1908989 3300041512 Bacteria 587
2668 Ga0451853_2139127 3300041512 Bacteria 799
2669 Ga0451853_2432839 3300041512 Bacteria 730
2670 Ga0451853_2729407 3300041512 Bacteria 741
2671 Ga0451853_3391543 3300041512 Bacteria 1324
2672 Ga0451853_3672688 3300041512 Bacteria 873
2673 Ga0452268_14895 3300041907 Bacteria 717
2674 Ga0452268_32184 3300041907 Bacteria 1351
2675 Ga0452271_89492 3300041916 Bacteria 572
2676 Ga0439431_0011173 3300041997 Bacteria 2047
2677 Ga0439431_0058601 3300041997 Bacteria 1009
2678 Ga0439433_0032158 3300041999 Bacteria 1203
2679 Ga0439433_0040294 3300041999 Bacteria 1086
2680 Ga0439437_013355 3300042000 Bacteria 954
2681 Ga0439437_039603 3300042000 Bacteria 609
2682 Ga0439442_001672 3300042002 Bacteria 4353
2683 Ga0439445_0009326 3300042004 Bacteria 2312
2684 Ga0439448_0012889 3300042005 Bacteria 2508
2685 Ga0439448_0025446 3300042005 Bacteria 1856
2686 Ga0439448_0026596 3300042005 Bacteria 1819
2687 Ga0439448_0280234 3300042005 Bacteria 590
2688 Ga0439432_010594 3300042006 Bacteria 3187
2689 Ga0439432_077695 3300042006 Bacteria 1007
2690 Ga0439432_111580 3300042006 Bacteria 813
2691 Ga0439432_164031 3300042006 Bacteria 649
2692 Ga0439449_0011395 3300042007 Bacteria 3346
2693 Ga0439449_0018870 3300042007 Bacteria 2585
2694 Ga0439449_0025348 3300042007 Bacteria 2217
2695 Ga0439449_0034459 3300042007 Bacteria 1885
2696 Ga0439449_0047245 3300042007 Bacteria 1594
2697 Ga0439449_0315608 3300042007 Bacteria 590
2698 Ga0439452_033713 3300042010 Bacteria 1241
2699 Ga0439454_012464 3300042011 Bacteria 1153
2700 Ga0439454_050179 3300042011 Bacteria 703
2701 Ga0439455_0063857 3300042012 Bacteria 980
2702 Ga0439456_082063 3300042013 Bacteria 720
2703 Ga0439457_020873 3300042014 Bacteria 1452
2704 Ga0439457_032229 3300042014 Bacteria 1163
2705 Ga0439462_0036100 3300042015 Bacteria 1315
2706 Ga0439462_0042436 3300042015 Bacteria 1215
2707 Ga0450911_032112 3300042115 Bacteria 681
2708 Ga0450919_011419 3300042121 Bacteria 1011
2709 Ga0450921_019547 3300042123 Bacteria 636
2710 Ga0450891_004918 3300042129 Bacteria 1242
2711 Ga0450895_017398 3300042132 Bacteria 651
2712 Ga0450898_034937 3300042134 Bacteria 935
2713 Ga0450899_016131 3300042135 Bacteria 854
2714 Ga0450906_011336 3300042145 Bacteria 1668
2715 Ga0450906_082296 3300042145 Bacteria 581
2716 Ga0450907_091350 3300042146 Bacteria 529
2717 Ga0439446_0080445 3300042156 Bacteria 1008
2718 Ga0439446_0123676 3300042156 Bacteria 834
2719 Ga0439458_0051278 3300042157 Bacteria 1019
2720 Ga0450908_001555 3300042184 Bacteria 4454
2721 Ga0450908_002828 3300042184 Bacteria 3374
2722 Ga0450909_024181 3300042185 Bacteria 912
2723 Ga0439434_0009664 3300042435 Bacteria 2836
2724 Ga0439434_0013723 3300042435 Bacteria 2406
2725 Ga0439459_0003452 3300042438 Bacteria 2510
2726 Ga0450916_083310 3300042530 Bacteria 548
2727 Ga0450893_0004794 3300042532 Bacteria 2159
2728 Ga0450893_0113121 3300042532 Bacteria 561
2729 Ga0451577_0000019 3300042876 Bacteria 506976
2730 Ga0451577_0027545 3300042876 Bacteria 5144
2731 Ga0451577_0824511 3300042876 Bacteria 837
2732 Ga0451577_1946079 3300042876 Bacteria 514
2733 Ga0466969_0008348 3300044656 Bacteria 5490
2734 Ga0466969_0008941 3300044656 Bacteria 5311
2735 Ga0466969_0342776 3300044656 Bacteria 676
2736 Ga0466972_0000416 3300044658 Bacteria 22317
2737 Ga0466972_0122579 3300044658 Bacteria 1225
2738 Ga0466982_0000005 3300044672 Bacteria 364340
2739 Ga0466982_0000210 3300044672 Bacteria 15368
2740 Ga0466965_0003853 3300044683 Bacteria 6624
2741 Ga0466965_0022934 3300044683 Bacteria 3011
2742 Ga0466966_0002549 3300044684 Bacteria 11933
2743 Ga0466966_0048560 3300044684 Bacteria 2703
2744 Ga0466961_0010336 3300044693 Bacteria 5951
2745 Ga0466961_0015293 3300044693 Bacteria 4928
2746 Ga0466961_0082193 3300044693 Bacteria 2038
2747 Ga0466961_0808313 3300044693 Bacteria 559
2748 Ga0466963_1255173 3300044694 Bacteria 520
2749 Ga0466964_0006055 3300044706 Bacteria 4507
2750 Ga0466964_0260014 3300044706 Bacteria 859
2751 Ga0453684_0000057 3300044712 Bacteria 506899
2752 Ga0453684_0000136 3300044712 Bacteria 323402
2753 Ga0453684_0009574 3300044712 Bacteria 16905
2754 Ga0453684_0303326 3300044712 Bacteria 1815
2755 Ga0453684_0851462 3300044712 Bacteria 980
2756 Ga0466971_0000338 3300044719 Bacteria 17942
2757 Ga0466971_0006109 3300044719 Bacteria 5237
2758 Ga0466971_0029817 3300044719 Bacteria 2440
2759 Ga0466971_0131518 3300044719 Bacteria 1162
2760 Ga0466971_0178935 3300044719 Bacteria 996
2761 Ga0466968_0000409 3300044735 Bacteria 14226
2762 Ga0466968_0012570 3300044735 Bacteria 3317
2763 Ga0466968_0036755 3300044735 Bacteria 2053
2764 Ga0466970_0000139 3300044765 Bacteria 33601
2765 Ga0466970_0001896 3300044765 Bacteria 10104
2766 Ga0466970_0170899 3300044765 Bacteria 1204
2767 Ga0466957_0003550 3300044842 Bacteria 8589
2768 Ga0466957_0019946 3300044842 Bacteria 3945
2769 Ga0466957_0036522 3300044842 Bacteria 2954
2770 Ga0466957_1189222 3300044842 Bacteria 551
2771 Ga0466960_0002345 3300044901 Bacteria 7115
2772 Ga0466960_0774625 3300044901 Bacteria 579
2773 Ga0466959_0018867 3300045049 Bacteria 5067
2774 Ga0466959_0025211 3300045049 Bacteria 4406
2775 Ga0466959_0033759 3300045049 Bacteria 3784
2776 Ga0466959_0043319 3300045049 Bacteria 3317
2777 Ga0451576_0000025 3300045051 Bacteria 427980
2778 Ga0451576_0018551 3300045051 Bacteria 7622
2779 Ga0451576_0106688 3300045051 Bacteria 2914
2780 Ga0451576_0239668 3300045051 Bacteria 1895
2781 Ga0451576_0441307 3300045051 Bacteria 1366
2782 Ga0466958_0005279 3300045836 Bacteria 6926
2783 Ga0466967_0090561 3300045976 Bacteria 2779
2784 Ga0466967_0163633 3300045976 Bacteria 2090
2785 Ga0466967_0504737 3300045976 Bacteria 1187
2786 Ga0466967_1556056 3300045976 Bacteria 658
2787 Ga0495617_005550 3300046452 Bacteria 4464
2788 Ga0495627_093979 3300046453 Bacteria 860
2789 Ga0495592_0607053 3300046454 Bacteria 667
2790 Ga0495629_0817283 3300046459 Bacteria 614
2791 Ga0495638_0000007 3300046460 Bacteria 602783
2792 Ga0495638_0006581 3300046460 Bacteria 8449
2793 Ga0495638_0055083 3300046460 Bacteria 2470
2794 Ga0495638_0236297 3300046460 Bacteria 1014
2795 Ga0495650_0000202 3300046471 Bacteria 129910
2796 Ga0495650_0011898 3300046471 Bacteria 4717
2797 Ga0495650_0030472 3300046471 Bacteria 2443
2798 Ga0495650_0114786 3300046471 Bacteria 996
2799 Ga0495605_0139180 3300046474 Bacteria 1090
2800 Ga0495639_0060355 3300046475 Bacteria 1737
2801 Ga0495584_0001537 3300046491 Bacteria 13711
2802 Ga0495585_0013800 3300046492 Bacteria 4720
2803 Ga0495585_0141188 3300046492 Bacteria 1261
2804 Ga0495607_0007223 3300046501 Bacteria 7709
2805 Ga0495607_0043874 3300046501 Bacteria 2640
2806 Ga0495607_0050504 3300046501 Bacteria 2420
2807 Ga0495583_0012059 3300046506 Bacteria 4921
2808 Ga0495606_0001329 3300046507 Bacteria 33751
2809 Ga0495606_0034951 3300046507 Bacteria 3442
2810 Ga0495606_0061245 3300046507 Bacteria 2407
2811 Ga0495606_0067053 3300046507 Bacteria 2273
2812 Ga0495610_0001380 3300046512 Bacteria 21565
2813 Ga0495610_0045466 3300046512 Bacteria 2172
2814 Ga0495610_0086172 3300046512 Bacteria 1431
2815 Ga0495616_0007049 3300046513 Bacteria 6755
2816 Ga0495620_0015281 3300046515 Bacteria 3879
2817 Ga0495620_0388345 3300046515 Bacteria 529
2818 Ga0495631_0000433 3300046518 Bacteria 28925
2819 Ga0495631_0372831 3300046518 Bacteria 607
2820 Ga0495632_0005327 3300046519 Bacteria 8538
2821 Ga0495632_0019213 3300046519 Bacteria 3728
2822 Ga0495632_0158223 3300046519 Bacteria 1044
2823 Ga0495637_0003535 3300046520 Bacteria 8283
2824 Ga0495637_0009169 3300046520 Bacteria 4831
2825 Ga0495643_0018809 3300046522 Bacteria 4003
2826 Ga0495648_0013709 3300046524 Bacteria 5976
2827 Ga0495663_0004473 3300046525 Bacteria 3926
2828 Ga0495663_0072031 3300046525 Bacteria 1102
2829 Ga0495663_0152058 3300046525 Bacteria 790
2830 Ga0495642_0022246 3300046528 Bacteria 2497
2831 Ga0495640_0538805 3300046533 Bacteria 708
2832 Ga0495640_0846716 3300046533 Bacteria 543
2833 Ga0495587_0265940 3300046536 Bacteria 963
2834 Ga0495587_0752514 3300046536 Bacteria 533
2835 Ga0495598_0391762 3300046537 Bacteria 542
2836 Ga0495609_0001578 3300046538 Bacteria 14896
2837 Ga0495621_0001470 3300046539 Bacteria 6111
2838 Ga0495621_0058222 3300046539 Bacteria 1397
2839 Ga0495621_0148177 3300046539 Bacteria 922
2840 Ga0495621_0317534 3300046539 Bacteria 648
2841 Ga0495645_0912251 3300046543 Bacteria 521
2842 Ga0495622_0008281 3300046557 Bacteria 4816
2843 Ga0495622_0071199 3300046557 Bacteria 1605
2844 Ga0495622_0180746 3300046557 Bacteria 946
2845 Ga0495622_0282969 3300046557 Bacteria 725
2846 Ga0495667_0328194 3300046559 Bacteria 968
2847 Ga0495656_0004814 3300046615 Bacteria 4645
2848 Ga0495656_0006174 3300046615 Bacteria 4190
2849 Ga0495668_0021331 3300046616 Bacteria 3716
2850 Ga0495634_0203741 3300046642 Bacteria 1228
2851 Ga0495611_0000029 3300046648 Bacteria 115887
2852 Ga0495625_0001724 3300046660 Bacteria 25395
2853 Ga0495625_0016676 3300046660 Bacteria 5771
2854 Ga0495625_0023820 3300046660 Bacteria 4671
2855 Ga0495625_0040795 3300046660 Bacteria 3382
2856 Ga0495625_0092189 3300046660 Bacteria 2093
2857 Ga0495625_0828324 3300046660 Bacteria 536
2858 Ga0495635_0346968 3300046663 Bacteria 991
2859 Ga0495659_0005979 3300046664 Bacteria 3847
2860 Ga0495661_0008049 3300046665 Bacteria 7318
2861 Ga0495661_0095190 3300046665 Bacteria 1687
2862 Ga0495588_0137598 3300046674 Bacteria 1289
2863 Ga0495588_0166384 3300046674 Bacteria 1166
2864 Ga0495646_0466220 3300046680 Bacteria 651
2865 Ga0495658_0077582 3300046683 Bacteria 1943
2866 Ga0495658_0374067 3300046683 Bacteria 907
2867 Ga0495658_0446652 3300046683 Bacteria 826
2868 Ga0495669_0536246 3300046684 Bacteria 569
2869 Ga0495670_0022396 3300046691 Bacteria 3120
2870 Ga0495670_0039605 3300046691 Bacteria 2350
2871 Ga0495670_0049122 3300046691 Bacteria 2110
2872 Ga0495671_0005114 3300046692 Bacteria 7717
2873 Ga0495671_0040313 3300046692 Bacteria 2355
2874 Ga0495671_0153520 3300046692 Bacteria 1121
2875 Ga0495649_0000383 3300046694 Bacteria 38398
2876 Ga0495649_0006659 3300046694 Bacteria 7174
2877 Ga0495589_0000144 3300046794 Bacteria 65654
2878 Ga0495600_0657407 3300046809 Bacteria 633
2879 Ga0495660_0003242 3300046810 Bacteria 10114
2880 Ga0495660_0270645 3300046810 Bacteria 781
2881 Ga0495636_0006169 3300047318 Bacteria 4707
2882 Ga0495636_0013988 3300047318 Bacteria 3188
2883 Ga0495636_0043510 3300047318 Bacteria 1868
2884 Ga0495672_0018426 3300047320 Bacteria 4634
2885 Ga0495676_0114966 3300047321 Bacteria 1968
2886 Ga0495680_0218621 3300047322 Bacteria 1361
2887 Ga0495683_0004657 3300047323 Bacteria 7733
2888 Ga0495677_0188672 3300047445 Bacteria 800
2889 Ga0495679_000001 3300047446 Bacteria 1607568
2890 Ga0495685_031122 3300047447 Bacteria 1835
2891 Ga0495685_088348 3300047447 Bacteria 1029
2892 Ga0495673_0004383 3300047469 Bacteria 8851
2893 Ga0495673_0005855 3300047469 Bacteria 7350
2894 Ga0495681_0082740 3300047470 Bacteria 1430
2895 Ga0495686_0002623 3300047472 Bacteria 16652
2896 Ga0495686_0008556 3300047472 Bacteria 7497
2897 Ga0495686_0184526 3300047472 Bacteria 1207
2898 Ga0495686_0584289 3300047472 Bacteria 580
2899 Ga0495614_0033308 3300048089 Bacteria 2216
2900 Ga0495615_0251764 3300048090 Bacteria 560
2901 Ga0496100_0006795 3300048903 Bacteria 6268
2902 Ga0496100_0372798 3300048903 Bacteria 1083
2903 Ga0496100_0469822 3300048903 Bacteria 966
2904 Ga0496101_0009854 3300048904 Bacteria 6293
2905 Ga0496101_0044571 3300048904 Bacteria 3174
2906 Ga0496101_0051842 3300048904 Bacteria 2957
2907 Ga0496101_0103046 3300048904 Bacteria 2138
2908 Ga0496101_0555201 3300048904 Bacteria 908
2909 Ga0496102_0048305 3300048905 Bacteria 3869
2910 Ga0496102_0061345 3300048905 Bacteria 3441
2911 Ga0496102_0125155 3300048905 Bacteria 2402
2912 Ga0496102_0402742 3300048905 Bacteria 1286
2913 Ga0496103_0075699 3300048906 Bacteria 2111
2914 Ga0496103_0247026 3300048906 Bacteria 1148
2915 Ga0496103_0423024 3300048906 Bacteria 855
2916 Ga0496103_0734865 3300048906 Bacteria 625
2917 Ga0496104_0045988 3300048907 Bacteria 4107
2918 Ga0496104_0731199 3300048907 Bacteria 897
2919 Ga0496104_1052529 3300048907 Bacteria 717
2920 Ga0496105_0016829 3300048908 Bacteria 5846
2921 Ga0496105_0041905 3300048908 Bacteria 3773
2922 Ga0496106_0003988 3300048909 Bacteria 11030
2923 Ga0496106_0008692 3300048909 Bacteria 7515
2924 Ga0496106_0031025 3300048909 Bacteria 3984
2925 Ga0496106_0069690 3300048909 Bacteria 2685
2926 Ga0496106_0249714 3300048909 Bacteria 1418
2927 Ga0496106_0572568 3300048909 Bacteria 906
2928 Ga0496107_0011190 3300048910 Bacteria 6245
2929 Ga0496107_0034298 3300048910 Bacteria 3635
2930 Ga0496107_0119848 3300048910 Bacteria 1938
2931 Ga0496107_0181248 3300048910 Bacteria 1564
2932 Ga0496107_0601376 3300048910 Bacteria 813
2933 Ga0496108_0001932 3300048911 Bacteria 16608
2934 Ga0496108_0080196 3300048911 Bacteria 2764
2935 Ga0496108_1065874 3300048911 Bacteria 688
2936 Ga0496109_0020058 3300048912 Bacteria 5904
2937 Ga0496109_0062064 3300048912 Bacteria 3417
2938 Ga0496109_0244032 3300048912 Bacteria 1691
2939 Ga0496109_0290479 3300048912 Bacteria 1541
2940 Ga0496109_1502972 3300048912 Bacteria 608
2941 Ga0496110_0011371 3300048913 Bacteria 7282
2942 Ga0496110_0159326 3300048913 Bacteria 2045
2943 Ga0496111_0003793 3300048914 Bacteria 9425
2944 Ga0496111_0074875 3300048914 Bacteria 2466
2945 Ga0496111_0634234 3300048914 Bacteria 781
2946 Ga0496112_0025726 3300048915 Bacteria 5652
2947 Ga0496112_0198029 3300048915 Bacteria 1969
2948 Ga0496112_0260527 3300048915 Bacteria 1683
2949 Ga0496112_1164660 3300048915 Bacteria 688
2950 Ga0496113_0029185 3300048916 Bacteria 3979
2951 Ga0496113_0046904 3300048916 Bacteria 3209
2952 Ga0496113_0159856 3300048916 Bacteria 1781
2953 Ga0496113_0658422 3300048916 Bacteria 837
2954 Ga0496114_0022208 3300048917 Bacteria 5169
2955 Ga0496114_0025860 3300048917 Bacteria 4801
2956 Ga0496114_0058872 3300048917 Bacteria 3208
2957 Ga0496114_0122348 3300048917 Bacteria 2239
2958 Ga0496114_1122096 3300048917 Bacteria 671
2959 Ga0496115_0002269 3300048918 Bacteria 13760
2960 Ga0496115_0027172 3300048918 Bacteria 4473
2961 Ga0496115_0128716 3300048918 Bacteria 2086
2962 Ga0496115_0375664 3300048918 Bacteria 1156
2963 Ga0496116_0059595 3300048919 Bacteria 2482
2964 Ga0496116_0143319 3300048919 Bacteria 1340
2965 Ga0496116_0200234 3300048919 Bacteria 1046
2966 Ga0496117_0026828 3300048920 Bacteria 4499
2967 Ga0496117_0028524 3300048920 Bacteria 4321
2968 Ga0496117_0032904 3300048920 Bacteria 3931
2969 Ga0496117_0050487 3300048920 Bacteria 2949
2970 Ga0496117_0108977 3300048920 Bacteria 1730
2971 Ga0496117_0334504 3300048920 Bacteria 788
2972 Ga0496118_0001647 3300048921 Bacteria 32855
2973 Ga0496118_0008397 3300048921 Bacteria 10682
2974 Ga0496118_0012660 3300048921 Bacteria 8071
2975 Ga0496118_0015010 3300048921 Bacteria 7202
2976 Ga0496118_0020758 3300048921 Bacteria 5816
2977 Ga0496118_0024725 3300048921 Bacteria 5173
2978 Ga0496118_0206013 3300048921 Bacteria 1159
2979 Ga0496118_0395792 3300048921 Bacteria 719
2980 Ga0496119_0014507 3300048922 Bacteria 6158
2981 Ga0496119_0016519 3300048922 Bacteria 5611
2982 Ga0496119_0447722 3300048922 Bacteria 609
2983 Ga0496119_0542842 3300048922 Bacteria 536
2984 Ga0496120_0005412 3300048923 Bacteria 10189
2985 Ga0496120_0024106 3300048923 Bacteria 3798
2986 Ga0496120_0055218 3300048923 Bacteria 2247
2987 Ga0496120_0219800 3300048923 Bacteria 908
2988 Ga0496120_0310249 3300048923 Bacteria 720
2989 Ga0496121_0000290 3300048924 Bacteria 104280
2990 Ga0496121_0005001 3300048924 Bacteria 17352
2991 Ga0496121_0016314 3300048924 Bacteria 7676
2992 Ga0496121_0034268 3300048924 Bacteria 4572
2993 Ga0496121_0042451 3300048924 Bacteria 3956
2994 Ga0496121_0053526 3300048924 Bacteria 3380
2995 Ga0496121_0053876 3300048924 Bacteria 3366
2996 Ga0496121_0090388 3300048924 Bacteria 2393
2997 Ga0496121_0128819 3300048924 Bacteria 1898
2998 Ga0496122_0001230 3300048925 Bacteria 43287
2999 Ga0496122_0002564 3300048925 Bacteria 25525
3000 Ga0496122_0060605 3300048925 Bacteria 2785
3001 Ga0496122_0080727 3300048925 Bacteria 2266
3002 Ga0496122_0101542 3300048925 Bacteria 1921
3003 Ga0496122_0141896 3300048925 Bacteria 1501
3004 Ga0496122_0177135 3300048925 Bacteria 1277
3005 Ga0496122_0212039 3300048925 Bacteria 1121
3006 Ga0496122_0289571 3300048925 Bacteria 890
3007 Ga0496123_0001008 3300048926 Bacteria 43023
3008 Ga0496123_0002427 3300048926 Bacteria 23189
3009 Ga0496123_0024610 3300048926 Bacteria 4570
3010 Ga0496123_0031047 3300048926 Bacteria 3897
3011 Ga0496123_0083888 3300048926 Bacteria 1924
3012 Ga0496123_0282827 3300048926 Bacteria 800
3013 Ga0496124_0000018 3300048927 Bacteria 442940
3014 Ga0496124_0000472 3300048927 Bacteria 69226
3015 Ga0496124_0027342 3300048927 Bacteria 5121
3016 Ga0496124_0192756 3300048927 Bacteria 1557
3017 Ga0496124_0609343 3300048927 Bacteria 709
3018 Ga0496124_0639966 3300048927 Bacteria 684
3019 Ga0496125_0000379 3300048928 Bacteria 83187
3020 Ga0496125_0024621 3300048928 Bacteria 5530
3021 Ga0496125_0040414 3300048928 Bacteria 4002
3022 Ga0496125_0042644 3300048928 Bacteria 3862
3023 Ga0496125_0062554 3300048928 Bacteria 2975
3024 Ga0496125_0072907 3300048928 Bacteria 2673
3025 Ga0496125_0159139 3300048928 Bacteria 1537
3026 Ga0496125_0171745 3300048928 Bacteria 1456
3027 Ga0496125_0525352 3300048928 Bacteria 661
3028 Ga0496126_0006212 3300048929 Bacteria 13367
3029 Ga0496126_0007636 3300048929 Bacteria 11804
3030 Ga0496126_0028743 3300048929 Bacteria 5292
3031 Ga0496126_0065751 3300048929 Bacteria 3244
3032 Ga0496126_0133819 3300048929 Bacteria 2140
3033 Ga0496126_0190237 3300048929 Bacteria 1739
3034 Ga0496126_0213639 3300048929 Bacteria 1623
3035 Ga0496126_0243418 3300048929 Bacteria 1501
3036 Ga0496126_1169051 3300048929 Bacteria 567
3037 Ga0496126_1297214 3300048929 Bacteria 530
3038 Ga0466983_0533056 3300048986 Bacteria 797
3039 Ga0501306_000035 3300049127 Bacteria 7508
3040 Ga0501306_000225 3300049127 Bacteria 3836
3041 Ga0501306_009088 3300049127 Bacteria 1226
3042 Ga0501306_030470 3300049127 Bacteria 799
3043 Ga0501306_032209 3300049127 Bacteria 784
3044 Ga0501306_072145 3300049127 Bacteria 584
3045 Ga0501306_102303 3300049127 Bacteria 514
3046 Ga0501308_000035 3300049128 Bacteria 5438
3047 Ga0501308_001234 3300049128 Bacteria 1989
3048 Ga0501308_002485 3300049128 Bacteria 1622
3049 Ga0501308_032326 3300049128 Bacteria 707
3050 Ga0501309_014517 3300049129 Bacteria 1058
3051 Ga0501309_073311 3300049129 Bacteria 565
3052 Ga0501310_000508 3300049130 Bacteria 3406
3053 Ga0501310_001848 3300049130 Bacteria 1959
3054 Ga0501310_004685 3300049130 Bacteria 1382
3055 Ga0501310_006398 3300049130 Bacteria 1235
3056 Ga0501310_011132 3300049130 Bacteria 1014
3057 Ga0501310_033118 3300049130 Bacteria 694
3058 Ga0501341_05765 3300049131 Bacteria 748
3059 Ga0501341_09254 3300049131 Bacteria 637
3060 Ga0501343_026582 3300049132 Bacteria 526
3061 Ga0501344_09653 3300049133 Bacteria 585
3062 Ga0501304_000125 3300049160 Bacteria 3033
3063 Ga0501304_000343 3300049160 Bacteria 2284
3064 Ga0501304_009401 3300049160 Bacteria 838
3065 Ga0501305_000082 3300049161 Bacteria 5535
3066 Ga0501305_013307 3300049161 Bacteria 1136
3067 Ga0501305_019665 3300049161 Bacteria 987
3068 Ga0501305_047998 3300049161 Bacteria 711
3069 Ga0501305_071479 3300049161 Bacteria 611
3070 Ga0501307_000021 3300049162 Bacteria 5538
3071 Ga0501307_000579 3300049162 Bacteria 2601
3072 Ga0501307_009289 3300049162 Bacteria 1122
3073 Ga0501307_025836 3300049162 Bacteria 790
3074 Ga0501307_041243 3300049162 Bacteria 671
3075 Ga0501307_081757 3300049162 Bacteria 528
3076 Ga0501307_092795 3300049162 Bacteria 506
3077 Ga0501342_04660 3300049163 Bacteria 509
3078 Ga0495678_004567 3300049459 Bacteria 7963
3079 Ga0495678_016742 3300049459 Bacteria 3341
3080 Ga0495682_0066105 3300049460 Bacteria 1303
3081 Ga0501291_051071 3300049514 Bacteria 753
3082 Ga0501292_097913 3300049515 Bacteria 578
3083 Ga0501294_018587 3300049517 Bacteria 738
3084 Ga0501298_041386 3300049521 Bacteria 935
3085 Ga0501311_000483 3300049527 Bacteria 2808
3086 Ga0501311_005607 3300049527 Bacteria 1382
3087 Ga0501311_015989 3300049527 Bacteria 974
3088 Ga0501311_021997 3300049527 Bacteria 873
3089 Ga0501311_087864 3300049527 Bacteria 536
3090 Ga0501312_000361 3300049528 Bacteria 3475
3091 Ga0501312_033689 3300049528 Bacteria 814
3092 Ga0501312_084155 3300049528 Bacteria 579
3093 Ga0501312_123766 3300049528 Bacteria 502
3094 Ga0501313_005644 3300049529 Bacteria 1329
3095 Ga0501313_063057 3300049529 Bacteria 528
3096 Ga0501314_000253 3300049530 Bacteria 3077
3097 Ga0501314_004226 3300049530 Bacteria 1185
3098 Ga0501315_000043 3300049531 Bacteria 5323
3099 Ga0501315_000712 3300049531 Bacteria 2463
3100 Ga0501315_000959 3300049531 Bacteria 2274
3101 Ga0501315_037510 3300049531 Bacteria 722
3102 Ga0501316_000017 3300049532 Bacteria 6637
3103 Ga0501316_005838 3300049532 Bacteria 1290
3104 Ga0501316_016799 3300049532 Bacteria 893
3105 Ga0501316_056936 3300049532 Bacteria 572
3106 Ga0501316_076228 3300049532 Bacteria 514
3107 Ga0501317_000519 3300049533 Bacteria 2771
3108 Ga0501317_003255 3300049533 Bacteria 1605
3109 Ga0501317_003443 3300049533 Bacteria 1579
3110 Ga0501317_038428 3300049533 Bacteria 722
3111 Ga0501318_004997 3300049534 Bacteria 1297
3112 Ga0501318_040657 3300049534 Bacteria 664
3113 Ga0501319_000067 3300049535 Bacteria 3492
3114 Ga0501319_000070 3300049535 Bacteria 3471
3115 Ga0501319_001738 3300049535 Bacteria 1304
3116 Ga0501319_003880 3300049535 Bacteria 1020
3117 Ga0501320_000093 3300049536 Bacteria 3938
3118 Ga0501320_002994 3300049536 Bacteria 1398
3119 Ga0501320_003078 3300049536 Bacteria 1388
3120 Ga0501321_002115 3300049537 Bacteria 1681
3121 Ga0501321_055097 3300049537 Bacteria 589
3122 Ga0501321_055213 3300049537 Bacteria 589
3123 Ga0501322_000356 3300049538 Bacteria 2071
3124 Ga0501322_004986 3300049538 Bacteria 908
3125 Ga0501323_000068 3300049539 Bacteria 5160
3126 Ga0501323_000101 3300049539 Bacteria 4591
3127 Ga0501323_000130 3300049539 Bacteria 4306
3128 Ga0501323_062191 3300049539 Bacteria 584
3129 Ga0501323_076553 3300049539 Bacteria 542
3130 Ga0501324_000043 3300049540 Bacteria 4242
3131 Ga0501324_021189 3300049540 Bacteria 665
3132 Ga0501324_038756 3300049540 Bacteria 540
3133 Ga0501325_000419 3300049541 Bacteria 1990
3134 Ga0501325_001699 3300049541 Bacteria 1402
3135 Ga0501325_002203 3300049541 Bacteria 1307
3136 Ga0501325_041336 3300049541 Bacteria 562
3137 Ga0501328_01513 3300049544 Bacteria 936
3138 Ga0501328_08502 3300049544 Bacteria 559
3139 Ga0501329_00634 3300049545 Bacteria 1315
3140 Ga0501329_00889 3300049545 Bacteria 1197
3141 Ga0501329_00991 3300049545 Bacteria 1158
3142 Ga0501330_015863 3300049546 Bacteria 575
3143 Ga0501330_024255 3300049546 Bacteria 501
3144 Ga0501331_07642 3300049547 Bacteria 646
3145 Ga0501331_11242 3300049547 Bacteria 564
3146 Ga0501331_11829 3300049547 Bacteria 554
3147 Ga0501332_01483 3300049548 Bacteria 1230
3148 Ga0501332_12884 3300049548 Bacteria 578
3149 Ga0501333_012765 3300049549 Bacteria 617
3150 Ga0501333_020476 3300049549 Bacteria 526
3151 Ga0501334_02106 3300049550 Bacteria 1160
3152 Ga0501334_12373 3300049550 Bacteria 633
3153 Ga0501335_001381 3300049551 Bacteria 1858
3154 Ga0501335_020727 3300049551 Bacteria 701
3155 Ga0501335_042952 3300049551 Bacteria 537
3156 Ga0501335_047668 3300049551 Bacteria 517
3157 Ga0501336_000152 3300049552 Bacteria 2827
3158 Ga0501336_000323 3300049552 Bacteria 2238
3159 Ga0501336_002665 3300049552 Bacteria 1159
3160 Ga0501336_003652 3300049552 Bacteria 1051
3161 Ga0501336_024562 3300049552 Bacteria 566
3162 Ga0501338_01526 3300049554 Bacteria 1249
3163 Ga0501338_05891 3300049554 Bacteria 766
3164 Ga0501340_000361 3300049556 Bacteria 1887
3165 Ga0501340_000766 3300049556 Bacteria 1546
3166 Ga0501340_006087 3300049556 Bacteria 802
3167 Ga0501340_009600 3300049556 Bacteria 699
3168 Ga0501031_0025141 3300049568 Bacteria 3884
3169 Ga0501031_0047206 3300049568 Bacteria 2807
3170 Ga0501031_0049682 3300049568 Bacteria 2733
3171 Ga0501031_0199292 3300049568 Bacteria 1306
3172 Ga0501031_0272582 3300049568 Bacteria 1098
3173 Ga0501031_0477891 3300049568 Bacteria 804
3174 Ga0501031_0606696 3300049568 Bacteria 704
3175 Ga0501031_0768878 3300049568 Bacteria 618
3176 Ga0501031_0908691 3300049568 Bacteria 563
3177 Ga0501032_0020602 3300049569 Bacteria 4590
3178 Ga0501032_0025237 3300049569 Bacteria 4098
3179 Ga0501032_0045411 3300049569 Bacteria 2971
3180 Ga0501032_0056009 3300049569 Bacteria 2651
3181 Ga0501032_0080851 3300049569 Bacteria 2162
3182 Ga0501032_0199653 3300049569 Bacteria 1305
3183 Ga0501032_1039952 3300049569 Bacteria 514
3184 Ga0501033_0000337 3300049570 Bacteria 44892
3185 Ga0501033_0004251 3300049570 Bacteria 11520
3186 Ga0501033_0014950 3300049570 Bacteria 5891
3187 Ga0501033_0017913 3300049570 Bacteria 5348
3188 Ga0501033_0080095 3300049570 Bacteria 2396
3189 Ga0501033_0082546 3300049570 Bacteria 2356
3190 Ga0501033_0147652 3300049570 Bacteria 1697
3191 Ga0501033_0216756 3300049570 Bacteria 1363
3192 Ga0501033_0405492 3300049570 Bacteria 950
3193 Ga0501033_0532740 3300049570 Bacteria 810
3194 Ga0501033_0967620 3300049570 Bacteria 570
3195 Ga0501034_0007020 3300049571 Bacteria 12012
3196 Ga0501034_0008263 3300049571 Bacteria 11016
3197 Ga0501034_0010161 3300049571 Bacteria 9819
3198 Ga0501034_0021966 3300049571 Bacteria 6502
3199 Ga0501034_0025504 3300049571 Bacteria 6019
3200 Ga0501034_0026172 3300049571 Bacteria 5940
3201 Ga0501034_0056333 3300049571 Bacteria 3955
3202 Ga0501034_0066470 3300049571 Bacteria 3618
3203 Ga0501034_0075626 3300049571 Bacteria 3374
3204 Ga0501034_0192626 3300049571 Bacteria 2000
3205 Ga0501034_0209790 3300049571 Bacteria 1903
3206 Ga0501034_0403009 3300049571 Bacteria 1290
3207 Ga0501034_0634627 3300049571 Bacteria 971
3208 Ga0501034_1022939 3300049571 Bacteria 709
3209 Ga0501036_0030355 3300049572 Bacteria 4566
3210 Ga0501036_0037846 3300049572 Bacteria 4080
3211 Ga0501036_0066357 3300049572 Bacteria 3053
3212 Ga0501036_0068501 3300049572 Bacteria 3003
3213 Ga0501036_0084334 3300049572 Bacteria 2686
3214 Ga0501036_0147118 3300049572 Bacteria 1987
3215 Ga0501036_0292945 3300049572 Bacteria 1361
3216 Ga0501036_1172272 3300049572 Bacteria 626
3217 Ga0501037_0021042 3300049573 Bacteria 4819
3218 Ga0501037_0021232 3300049573 Bacteria 4797
3219 Ga0501037_0066649 3300049573 Bacteria 2622
3220 Ga0501037_0070227 3300049573 Bacteria 2548
3221 Ga0501037_0119741 3300049573 Bacteria 1893
3222 Ga0501037_0282726 3300049573 Bacteria 1156
3223 Ga0501037_0314761 3300049573 Bacteria 1084
3224 Ga0501037_0837925 3300049573 Bacteria 605
3225 Ga0501037_1156040 3300049573 Bacteria 500
3226 Ga0501038_0002396 3300049574 Bacteria 17463
3227 Ga0501038_0005917 3300049574 Bacteria 11307
3228 Ga0501038_0013134 3300049574 Bacteria 7553
3229 Ga0501038_0026720 3300049574 Bacteria 5139
3230 Ga0501038_0059410 3300049574 Bacteria 3275
3231 Ga0501038_0076438 3300049574 Bacteria 2828
3232 Ga0501038_0091007 3300049574 Bacteria 2556
3233 Ga0501038_0163124 3300049574 Bacteria 1809
3234 Ga0501038_0185128 3300049574 Bacteria 1678
3235 Ga0501039_0013271 3300049575 Bacteria 6300
3236 Ga0501039_0036074 3300049575 Bacteria 3814
3237 Ga0501039_0079649 3300049575 Bacteria 2548
3238 Ga0501039_0108800 3300049575 Bacteria 2166
3239 Ga0501039_0123447 3300049575 Bacteria 2030
3240 Ga0501039_0461883 3300049575 Bacteria 997
3241 Ga0501039_1361609 3300049575 Bacteria 547
3242 Ga0501040_0101178 3300049576 Bacteria 2010
3243 Ga0501040_1093197 3300049576 Bacteria 578
3244 Ga0501041_0259926 3300049577 Bacteria 1092
3245 Ga0501042_0049962 3300049578 Bacteria 2983
3246 Ga0501042_0466993 3300049578 Bacteria 915
3247 Ga0501042_0614294 3300049578 Bacteria 790
3248 Ga0501043_0004937 3300049579 Bacteria 10784
3249 Ga0501043_0016278 3300049579 Bacteria 5832
3250 Ga0501043_0030616 3300049579 Bacteria 4230
3251 Ga0501043_0136461 3300049579 Bacteria 1921
3252 Ga0501043_0171694 3300049579 Bacteria 1691
3253 Ga0501043_0179483 3300049579 Bacteria 1650
3254 Ga0501043_0281565 3300049579 Bacteria 1274
3255 Ga0501043_0363339 3300049579 Bacteria 1098
3256 Ga0501043_0467547 3300049579 Bacteria 945
3257 Ga0501043_0535642 3300049579 Bacteria 871
3258 Ga0501043_0934761 3300049579 Bacteria 620
3259 Ga0501046_0015318 3300049580 Bacteria 6448
3260 Ga0501046_0025093 3300049580 Bacteria 4882
3261 Ga0501046_0034206 3300049580 Bacteria 4102
3262 Ga0501046_0077141 3300049580 Bacteria 2580
3263 Ga0501046_0103560 3300049580 Bacteria 2181
3264 Ga0501046_0174084 3300049580 Bacteria 1613
3265 Ga0501046_0353049 3300049580 Bacteria 1067
3266 Ga0501046_0403200 3300049580 Bacteria 987
3267 Ga0501046_0851172 3300049580 Bacteria 637
3268 Ga0501046_1003698 3300049580 Bacteria 579
3269 Ga0501047_0000250 3300049581 Bacteria 63699
3270 Ga0501047_0059275 3300049581 Bacteria 3696
3271 Ga0501047_0135727 3300049581 Bacteria 2340
3272 Ga0501047_0165041 3300049581 Bacteria 2085
3273 Ga0501047_0173969 3300049581 Bacteria 2021
3274 Ga0501047_0219719 3300049581 Bacteria 1756
3275 Ga0501047_0286485 3300049581 Bacteria 1491
3276 Ga0501047_0290604 3300049581 Bacteria 1478
3277 Ga0501047_0322832 3300049581 Bacteria 1383
3278 Ga0501047_1233665 3300049581 Bacteria 561
3279 Ga0501047_1387500 3300049581 Bacteria 517
3280 Ga0501048_0021518 3300049582 Bacteria 4723
3281 Ga0501048_0029557 3300049582 Bacteria 3972
3282 Ga0501048_0168984 3300049582 Bacteria 1548
3283 Ga0501048_0287708 3300049582 Bacteria 1169
3284 Ga0501067_0015294 3300049583 Bacteria 4246
3285 Ga0501067_0019365 3300049583 Bacteria 3766
3286 Ga0501067_0071749 3300049583 Bacteria 1918
3287 Ga0501067_0174193 3300049583 Bacteria 1198
3288 Ga0501068_0054791 3300049584 Bacteria 2415
3289 Ga0501068_0260816 3300049584 Bacteria 1105
3290 Ga0501068_0264389 3300049584 Bacteria 1098
3291 Ga0501068_0402414 3300049584 Bacteria 883
3292 Ga0501068_0582825 3300049584 Bacteria 728
3293 Ga0501069_0009337 3300049585 Bacteria 5178
3294 Ga0501069_0022029 3300049585 Bacteria 3462
3295 Ga0501069_0036066 3300049585 Bacteria 2725
3296 Ga0501069_0245209 3300049585 Bacteria 1044
3297 Ga0501069_0289542 3300049585 Bacteria 959
3298 Ga0501069_0311276 3300049585 Bacteria 924
3299 Ga0501069_0386053 3300049585 Bacteria 828
3300 Ga0501069_0872022 3300049585 Bacteria 547
3301 Ga0501070_0016046 3300049586 Bacteria 6294
3302 Ga0501070_0033540 3300049586 Bacteria 4296
3303 Ga0501070_0033585 3300049586 Bacteria 4293
3304 Ga0501070_0038865 3300049586 Bacteria 3971
3305 Ga0501070_0041063 3300049586 Bacteria 3854
3306 Ga0501070_0042967 3300049586 Bacteria 3762
3307 Ga0501070_0152670 3300049586 Bacteria 1905
3308 Ga0501070_0159631 3300049586 Bacteria 1859
3309 Ga0501070_0261210 3300049586 Bacteria 1415
3310 Ga0501070_0285297 3300049586 Bacteria 1346
3311 Ga0501070_0561279 3300049586 Bacteria 913
3312 Ga0501070_0783878 3300049586 Bacteria 749
3313 Ga0501071_0037161 3300049587 Bacteria 3476
3314 Ga0501071_0154318 3300049587 Bacteria 1714
3315 Ga0501071_1106111 3300049587 Bacteria 612
3316 Ga0501072_0021878 3300049588 Bacteria 4960
3317 Ga0501072_0097845 3300049588 Bacteria 2332
3318 Ga0501072_0311623 3300049588 Bacteria 1251
3319 Ga0501072_1233169 3300049588 Bacteria 580
3320 Ga0501073_0000196 3300049589 Bacteria 40033
3321 Ga0501073_0008863 3300049589 Bacteria 7436
3322 Ga0501073_0062427 3300049589 Bacteria 2599
3323 Ga0501073_0143881 3300049589 Bacteria 1652
3324 Ga0501073_0145837 3300049589 Bacteria 1640
3325 Ga0501073_0253984 3300049589 Bacteria 1213
3326 Ga0501073_0328643 3300049589 Bacteria 1055
3327 Ga0501073_0553918 3300049589 Bacteria 794
3328 Ga0501074_0023356 3300049590 Bacteria 4496
3329 Ga0501074_0028113 3300049590 Bacteria 4075
3330 Ga0501074_0029861 3300049590 Bacteria 3950
3331 Ga0501074_0031616 3300049590 Bacteria 3834
3332 Ga0501074_0037471 3300049590 Bacteria 3514
3333 Ga0501074_0040153 3300049590 Bacteria 3390
3334 Ga0501074_0097830 3300049590 Bacteria 2100
3335 Ga0501074_0404991 3300049590 Bacteria 967
3336 Ga0501074_0601228 3300049590 Bacteria 778
3337 Ga0501076_0042220 3300049592 Bacteria 3590
3338 Ga0501076_1039158 3300049592 Bacteria 675
3339 Ga0501077_0528580 3300049593 Bacteria 757
3340 Ga0501077_0745800 3300049593 Bacteria 629
3341 Ga0501198_024968 3300049649 Bacteria 969
3342 Ga0501201_010017 3300049651 Bacteria 926
3343 Ga0501202_005500 3300049652 Bacteria 2244
3344 Ga0501202_155020 3300049652 Bacteria 602
3345 Ga0501208_047426 3300049655 Bacteria 811
3346 Ga0501211_040584 3300049658 Bacteria 553
3347 Ga0501216_029379 3300049660 Bacteria 1008
3348 Ga0501217_024102 3300049661 Bacteria 1453
3349 Ga0501223_049764 3300049663 Bacteria 813
3350 Ga0501233_122410 3300049668 Bacteria 704
3351 Ga0501238_083471 3300049671 Bacteria 504
3352 Ga0501239_032668 3300049672 Bacteria 689
3353 Ga0501240_021223 3300049673 Bacteria 979
3354 Ga0501242_019868 3300049674 Bacteria 861
3355 Ga0501243_023627 3300049675 Bacteria 1023
3356 Ga0501246_003367 3300049676 Bacteria 1286
3357 Ga0501248_059146 3300049678 Bacteria 508
3358 Ga0501249_015941 3300049679 Bacteria 1610
3359 Ga0501250_002526 3300049680 Bacteria 1665
3360 Ga0501252_000295 3300049682 Bacteria 3545
3361 Ga0501253_005515 3300049683 Bacteria 1664
3362 Ga0501257_001372 3300049686 Bacteria 5019
3363 Ga0501257_096202 3300049686 Bacteria 774
3364 Ga0501258_010110 3300049687 Bacteria 994
3365 Ga0501259_018185 3300049688 Bacteria 1225
3366 Ga0501261_028813 3300049690 Bacteria 832
3367 Ga0501225_0016391 3300049705 Bacteria 2060
3368 Ga0501225_0037836 3300049705 Bacteria 1329
3369 Ga0501225_0040103 3300049705 Bacteria 1290
3370 Ga0501225_0085336 3300049705 Bacteria 910
3371 Ga0501225_0100543 3300049705 Bacteria 845
3372 Ga0501234_092362 3300049707 Bacteria 544
3373 Ga0501079_0140789 3300049741 Bacteria 1879
3374 Ga0501079_0167965 3300049741 Bacteria 1711
3375 Ga0501079_0174269 3300049741 Bacteria 1677
3376 Ga0501079_0443597 3300049741 Bacteria 1019
3377 Ga0501079_0466944 3300049741 Bacteria 991
3378 Ga0501079_0781760 3300049741 Bacteria 751
3379 Ga0501080_0005488 3300049742 Bacteria 11318
3380 Ga0501080_0011521 3300049742 Bacteria 8096
3381 Ga0501080_0018310 3300049742 Bacteria 6482
3382 Ga0501080_0021132 3300049742 Bacteria 6023
3383 Ga0501080_0021405 3300049742 Bacteria 5985
3384 Ga0501080_0036209 3300049742 Bacteria 4607
3385 Ga0501080_0045089 3300049742 Bacteria 4104
3386 Ga0501080_0049719 3300049742 Bacteria 3902
3387 Ga0501080_0075188 3300049742 Bacteria 3142
3388 Ga0501080_0125203 3300049742 Bacteria 2380
3389 Ga0501080_0634277 3300049742 Bacteria 946
3390 Ga0501081_0223592 3300049743 Bacteria 1369
3391 Ga0501083_0018874 3300049744 Bacteria 4801
3392 Ga0501083_0021386 3300049744 Bacteria 4495
3393 Ga0501083_0035514 3300049744 Bacteria 3404
3394 Ga0501083_1013307 3300049744 Bacteria 540
3395 Ga0501232_002388 3300049757 Bacteria 1626
3396 Ga0501241_042149 3300049758 Bacteria 887
3397 Ga0501262_000066 3300049759 Bacteria 12613
3398 Ga0501262_021896 3300049759 Bacteria 880
3399 Ga0501264_025261 3300049761 Bacteria 654
3400 Ga0501268_005031 3300049765 Bacteria 1883
3401 Ga0501269_017938 3300049766 Bacteria 876
3402 Ga0501270_002142 3300049767 Bacteria 1992
3403 Ga0501270_053341 3300049767 Bacteria 738
3404 Ga0501274_002795 3300049771 Bacteria 1378
3405 Ga0501275_059346 3300049772 Bacteria 579
3406 Ga0501276_029898 3300049773 Bacteria 564
3407 Ga0501282_008793 3300049778 Bacteria 1084
3408 Ga0501035_0003746 3300049822 Bacteria 14504
3409 Ga0501035_0021041 3300049822 Bacteria 5996
3410 Ga0501035_0043348 3300049822 Bacteria 4055
3411 Ga0501035_0043368 3300049822 Bacteria 4053
3412 Ga0501035_0055245 3300049822 Bacteria 3545
3413 Ga0501035_0109734 3300049822 Bacteria 2418
3414 Ga0501035_0123668 3300049822 Bacteria 2259
3415 Ga0501035_0171448 3300049822 Bacteria 1874
3416 Ga0501035_0431671 3300049822 Bacteria 1092
3417 Ga0501035_0454260 3300049822 Bacteria 1059
3418 Ga0501035_0898811 3300049822 Bacteria 701
3419 Ga0501035_1417258 3300049822 Bacteria 532
3420 Ga0501044_0003730 3300049823 Bacteria 17110
3421 Ga0501044_0036733 3300049823 Bacteria 5123
3422 Ga0501044_0043547 3300049823 Bacteria 4662
3423 Ga0501044_0053687 3300049823 Bacteria 4145
3424 Ga0501044_0070126 3300049823 Bacteria 3566
3425 Ga0501044_0128695 3300049823 Bacteria 2527
3426 Ga0501044_0129150 3300049823 Bacteria 2522
3427 Ga0501044_0147413 3300049823 Bacteria 2337
3428 Ga0501044_0148736 3300049823 Bacteria 2325
3429 Ga0501044_0220026 3300049823 Bacteria 1849
3430 Ga0501044_0268833 3300049823 Bacteria 1641
3431 Ga0501044_0341586 3300049823 Bacteria 1418
3432 Ga0501044_0409970 3300049823 Bacteria 1266
3433 Ga0501044_0501840 3300049823 Bacteria 1114
3434 Ga0501044_1127400 3300049823 Bacteria 653
3435 Ga0501045_0042206 3300049824 Bacteria 3320
3436 Ga0501045_0222616 3300049824 Bacteria 1405
3437 Ga0501045_0285322 3300049824 Bacteria 1229
3438 Ga0501045_0623554 3300049824 Bacteria 798
3439 Ga0501212_115757 3300049851 Bacteria 516
3440 Ga0501226_014778 3300049853 Bacteria 862
3441 nmdc:mga03683_119959_c1 3300050489 Bacteria 1169
3442 nmdc:mga03683_187770_c1 3300050489 Bacteria 945
3443 nmdc:mga03683_72383_c1 3300050489 Bacteria 1476
3444 nmdc:mga03n38_105928_c1 3300050490 Bacteria 1363
3445 nmdc:mga03n38_267255_c1 3300050490 Bacteria 909
3446 nmdc:mga00v17_16326_c1 3300050491 Bacteria 4186
3447 nmdc:mga00v17_26417_c1 3300050491 Bacteria 3384
3448 nmdc:mga00v17_59069_c2 3300050491 Bacteria 1705
3449 nmdc:mga00v17_715126_c1 3300050491 Bacteria 641
3450 nmdc:mga00v17_8118_c1 3300050491 Bacteria 5635
3451 nmdc:mga00v17_87217_c1 3300050491 Bacteria 1956
3452 nmdc:mga0yw44_173980_c1 3300050492 Bacteria 1415
3453 nmdc:mga0yw44_46615_c1 3300050492 Bacteria 2604
3454 nmdc:mga0yw44_631391_c1 3300050492 Bacteria 728
3455 nmdc:mga0k408_172217_c1 3300050493 Bacteria 1291
3456 nmdc:mga0k408_310974_c1 3300050493 Bacteria 940
3457 nmdc:mga0k408_571442_c1 3300050493 Bacteria 668
3458 nmdc:mga0k408_717214_c1 3300050493 Bacteria 585
3459 nmdc:mga0k408_72253_c1 3300050493 Bacteria 2015
3460 nmdc:mga04h51_37470_c1 3300050495 Bacteria 1565
3461 nmdc:mga07m45_124840_c2 3300050496 Bacteria 935
3462 nmdc:mga07m45_273534_c1 3300050496 Bacteria 983
3463 nmdc:mga07m45_47114_c1 3300050496 Bacteria 2423
3464 nmdc:mga07m45_65139_c1 3300050496 Bacteria 2069
3465 nmdc:mga06r32_193219_c1 3300050510 Bacteria 2022
3466 nmdc:mga08y16_740964_c1 3300050511 Bacteria 979
3467 nmdc:mga0rr50_660293_c1 3300050513 Bacteria 892
3468 nmdc:mga08x19_1005121_c1 3300050514 Bacteria 592
3469 nmdc:mga0sz30_144290_c1 3300050516 Bacteria 1052
3470 nmdc:mga0sz30_239801_c1 3300050516 Bacteria 807
3471 nmdc:mga0sz30_381982_c1 3300050516 Bacteria 631
3472 nmdc:mga0sz30_85457_c1 3300050516 Bacteria 1369
3473 Ga0500610_0000159 3300053079 Bacteria 20234
3474 Ga0500610_0134209 3300053079 Bacteria 1255
3475 Ga0500635_0190763 3300053080 Bacteria 794
3476 Ga0500643_000120 3300053087 Bacteria 81701
3477 Ga0500643_001959 3300053087 Bacteria 11154
3478 Ga0500643_034713 3300053087 Bacteria 1517
3479 Ga0500643_073982 3300053087 Bacteria 943
3480 Ga0500644_0114733 3300053088 Bacteria 1042
3481 Ga0500583_0373379 3300053092 Bacteria 688
3482 Ga0500651_0000076 3300053093 Bacteria 63637
3483 Ga0500651_0003432 3300053093 Bacteria 8658
3484 Ga0500566_0491514 3300053094 Bacteria 530
3485 Ga0500555_001368 3300053103 Bacteria 7599
3486 Ga0500555_087885 3300053103 Bacteria 801
3487 Ga0500562_022886 3300053108 Bacteria 1629
3488 Ga0500562_074497 3300053108 Bacteria 917
3489 Ga0500571_068468 3300053110 Bacteria 1800
3490 Ga0500593_167349 3300053117 Bacteria 832
3491 Ga0500594_0014129 3300053118 Bacteria 1908
3492 Ga0500594_0336939 3300053118 Bacteria 507
3493 Ga0500597_006025 3300053120 Bacteria 3976
3494 Ga0500597_062838 3300053120 Bacteria 1597
3495 Ga0500607_037256 3300053121 Bacteria 2651
3496 Ga0500618_090336 3300053125 Bacteria 688
3497 Ga0500655_010077 3300053133 Bacteria 1704
3498 Ga0500658_0000913 3300053134 Bacteria 12085
3499 Ga0500658_0265708 3300053134 Bacteria 789
3500 Ga0500559_0017155 3300053136 Bacteria 3057
3501 Ga0500559_0083948 3300053136 Bacteria 1451
3502 Ga0500559_0502818 3300053136 Bacteria 556
3503 Ga0500564_337665 3300053138 Bacteria 565
3504 Ga0500568_0005392 3300053139 Bacteria 6614
3505 Ga0500577_0171394 3300053142 Bacteria 928
3506 Ga0500588_0196933 3300053146 Bacteria 745
3507 Ga0500616_0013427 3300053153 Bacteria 4755
3508 Ga0500616_0427653 3300053153 Bacteria 525
3509 Ga0500633_0000338 3300053160 Bacteria 7069
3510 Ga0500634_0003199 3300053161 Bacteria 7212
3511 Ga0500634_0017209 3300053161 Bacteria 3868
3512 Ga0500634_0233380 3300053161 Bacteria 779
3513 Ga0500639_225152 3300053163 Bacteria 778
3514 Ga0500636_0464911 3300053177 Bacteria 568
3515 Ga0500645_004128 3300053730 Bacteria 5663
3516 Ga0501084_0031132 3300054114 Bacteria 4463
3517 Ga0501084_0218263 3300054114 Bacteria 1609
3518 Ga0501084_0579168 3300054114 Bacteria 948
3519 Ga0501084_0786601 3300054114 Bacteria 801
3520 Ga0501084_1842066 3300054114 Bacteria 505
3521 Ga0500661_013666 3300055283 Bacteria 1463
3522 Ga0500661_024258 3300055283 Bacteria 1073
3523 Ga0590071_031895 3300059421 Bacteria 1257
3524 Ga0590071_207707 3300059421 Bacteria 516
3525 Ga0587084_001228 3300059477 Bacteria 2381
3526 Ga0587084_077374 3300059477 Bacteria 639
3527 Ga0587084_085017 3300059477 Bacteria 619
3528 Ga0587093_002581 3300059478 Bacteria 1700
3529 Ga0587093_008173 3300059478 Bacteria 1186
3530 Ga0587066_071241 3300059490 Bacteria 732
3531 Ga0587070_028246 3300059491 Bacteria 999
3532 Ga0587070_130338 3300059491 Bacteria 611
3533 Ga0587073_0000278 3300059492 Bacteria 4139
3534 Ga0587077_017106 3300059493 Bacteria 1231
3535 Ga0587077_024321 3300059493 Bacteria 1101
3536 Ga0587077_065398 3300059493 Bacteria 799
3537 Ga0587077_109869 3300059493 Bacteria 674
3538 Ga0587080_000220 3300059503 Bacteria 4144
3539 Ga0587080_028410 3300059503 Bacteria 960
3540 Ga0587080_050191 3300059503 Bacteria 786
3541 Ga0587082_000004 3300059504 Bacteria 11540
3542 Ga0587083_0002339 3300059505 Bacteria 2344
3543 Ga0587083_0016520 3300059505 Bacteria 1307
3544 Ga0587083_0110553 3300059505 Bacteria 697
3545 Ga0587085_063822 3300059506 Bacteria 704
3546 Ga0587086_014710 3300059507 Bacteria 1002
3547 Ga0587088_047669 3300059508 Bacteria 829
3548 Ga0587089_078718 3300059509 Bacteria 570
3549 Ga0587090_000294 3300059510 Bacteria 3859
3550 Ga0587090_012962 3300059510 Bacteria 1198
3551 Ga0587090_062157 3300059510 Bacteria 711
3552 Ga0587090_062158 3300059510 Bacteria 711
3553 Ga0587090_126137 3300059510 Bacteria 560
3554 Ga0587091_010383 3300059511 Bacteria 1424
3555 Ga0587092_009534 3300059512 Bacteria 1307
3556 Ga0587094_003374 3300059513 Bacteria 1737
3557 Ga0587098_000913 3300059604 Bacteria 2073
3558 Ga0587098_021321 3300059604 Bacteria 826
3559 Ga0587098_023827 3300059604 Bacteria 798
3560 Ga0587106_000089 3300059605 Bacteria 4305
3561 Ga0587106_000773 3300059605 Bacteria 2499
3562 Ga0587106_070278 3300059605 Bacteria 662
3563 Ga0587106_088196 3300059605 Bacteria 615
3564 Ga0587129_011403 3300059608 Bacteria 699
3565 Ga0587101_032821 3300059623 Bacteria 819
3566 Ga0587101_066537 3300059623 Bacteria 655
3567 Ga0587109_019045 3300059624 Bacteria 1206
3568 Ga0587109_194549 3300059624 Bacteria 525
3569 Ga0587113_009735 3300059625 Bacteria 875
3570 Ga0587117_082114 3300059627 Bacteria 589
3571 Ga0587117_083248 3300059627 Bacteria 586
3572 Ga0587128_015846 3300059630 Bacteria 1097
3573 Ga0587128_029497 3300059630 Bacteria 900
3574 Ga0587128_163839 3300059630 Bacteria 514
3575 Ga0587062_006615 3300059639 Bacteria 1324
3576 Ga0587067_000324 3300059640 Bacteria 3931
3577 Ga0587067_000398 3300059640 Bacteria 3711
3578 Ga0587067_011719 3300059640 Bacteria 1356
3579 Ga0587068_023959 3300059641 Bacteria 1020
3580 Ga0587068_087023 3300059641 Bacteria 639
3581 Ga0587069_100053 3300059642 Bacteria 591
3582 Ga0587069_135855 3300059642 Bacteria 534
3583 Ga0587072_001029 3300059643 Bacteria 3253
3584 Ga0587072_002394 3300059643 Bacteria 2500
3585 Ga0587072_036139 3300059643 Bacteria 943
3586 Ga0587072_177743 3300059643 Bacteria 529
3587 Ga0587075_021051 3300059644 Bacteria 969
3588 Ga0587076_009931 3300059645 Bacteria 1363
3589 Ga0587076_019376 3300059645 Bacteria 1105
3590 Ga0587076_031592 3300059645 Bacteria 942
3591 Ga0587076_068994 3300059645 Bacteria 730
3592 Ga0587076_159517 3300059645 Bacteria 554
3593 Ga0587076_162336 3300059645 Bacteria 550
3594 Ga0587078_004788 3300059646 Bacteria 1425
3595 Ga0587078_015465 3300059646 Bacteria 921
3596 Ga0587078_017510 3300059646 Bacteria 880
3597 Ga0587078_032781 3300059646 Bacteria 707
3598 Ga0587079_019498 3300059647 Bacteria 1201
3599 Ga0587079_080501 3300059647 Bacteria 744
3600 Ga0587100_015560 3300059648 Bacteria 697
3601 Ga0587105_000202 3300059651 Bacteria 2114
3602 Ga0587107_013340 3300059652 Bacteria 1040
3603 Ga0587108_001563 3300059653 Bacteria 1423
3604 Ga0587114_132590 3300059655 Bacteria 514
3605 Ga0587118_03174 3300059657 Bacteria 1097
3606 Ga0587119_079894 3300059658 Bacteria 531
3607 Ga0587124_047643 3300059660 Bacteria 515
3608 Ga0587124_048182 3300059660 Bacteria 514
3609 Ga0587071_013628 3300060344 Bacteria 1403
3610 Ga0587071_016267 3300060344 Bacteria 1315
3611 Ga0587071_043226 3300060344 Bacteria 910
3612 Ga0587071_052920 3300060344 Bacteria 844
3613 Ga0587071_102579 3300060344 Bacteria 664
3614 Ga0587071_112273 3300060344 Bacteria 642
3615 Ga0587071_133884 3300060344 Bacteria 603
3616 Ga0587071_210935 3300060344 Bacteria 512
3617 Ga0587111_0004434 3300060346 Bacteria 2088
3618 Ga0587111_0013258 3300060346 Bacteria 1469
3619 Ga0501082_0017750 3300060353 Bacteria 6128
3620 Ga0501082_0155579 3300060353 Bacteria 1986
3621 Ga0501082_0269195 3300060353 Bacteria 1483
3622 Ga0501082_0521805 3300060353 Bacteria 1038
3623 Ga0501082_0573216 3300060353 Bacteria 987
3624 Ga0466962_0007521 3300061719 Bacteria 5225
3625 Ga0466962_0088906 3300061719 Bacteria 1479
3626 Ga0466962_0115984 3300061719 Bacteria 1290
3627 Ga0466962_0215049 3300061719 Bacteria 940
3628 Ga0530510_0163863 3300061734 Bacteria 1645
3629 Ga0530510_0646893 3300061734 Bacteria 805

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_1062292 Ga0395901_1062292_292_558 76
2 3300049570 Ga0501033_0967620 Ga0501033_0967620_76_315 76
3 3300049573 Ga0501037_1156040 Ga0501037_1156040_172_411 76
4 3300049575 Ga0501039_1361609 Ga0501039_1361609_195_434 76
5 3300049576 Ga0501040_1093197 Ga0501040_1093197_199_438 76
6 3300049578 Ga0501042_0614294 Ga0501042_0614294_183_422 76
7 3300049579 Ga0501043_0934761 Ga0501043_0934761_85_324 76
8 3300049580 Ga0501046_1003698 Ga0501046_1003698_175_414 76
9 3300049582 Ga0501048_0287708 Ga0501048_0287708_276_515 76
10 3300049584 Ga0501068_0402414 Ga0501068_0402414_173_412 76
11 3300049587 Ga0501071_0154318 Ga0501071_0154318_895_1134 76
12 3300049588 Ga0501072_1233169 Ga0501072_1233169_79_318 76
13 3300049592 Ga0501076_1039158 Ga0501076_1039158_243_482 76
14 3300049593 Ga0501077_0745800 Ga0501077_0745800_331_570 76
15 3300049741 Ga0501079_0167965 Ga0501079_0167965_220_459 76
16 3300054114 Ga0501084_0579168 Ga0501084_0579168_527_766 76
17 3300060353 Ga0501082_0269195 Ga0501082_0269195_93_332 76
18 3300061734 Ga0530510_0646893 Ga0530510_0646893_177_416 76
19 iso_pu_bacteria 2894414249 2894414498 83
20 iso_pu_bacteria 2895498888 2895501296 84
21 iso_pu_bacteria 2895511927 2895514439 84
22 iso_pu_bacteria 2895522137 2895524079 84
23 iso_pu_bacteria 2895525241 2895527567 84
24 iso_pu_bacteria 2524614729 2525556154 85
25 iso_pu_bacteria 2547132130 2547502386 85
26 iso_pu_bacteria 2576861471 2578459520 85
27 iso_pu_bacteria 2627854209 2630648936 85
28 iso_pu_bacteria 2643221559 2643816131 85
29 iso_pu_bacteria 2643221573 2643877937 85
30 iso_pu_bacteria 2643221579 2643906205 85
31 iso_pu_bacteria 2643221581 2643915225 85
32 iso_pu_bacteria 2643221586 2643938159 85
33 iso_pu_bacteria 2643221593 2643975364 85
34 iso_pu_bacteria 2643221612 2644077731 85
35 iso_pu_bacteria 2643221695 2644530914 85
36 iso_pu_bacteria 2643221720 2644659247 85
37 iso_pu_bacteria 2643221727 2644695976 85
38 iso_pu_bacteria 2643221728 2644698585 85
39 iso_pu_bacteria 2747842428 2747950331 85
40 iso_pu_bacteria 2747842501 2748018119 85
41 iso_pu_bacteria 2765235840 2765577786 85
42 iso_pu_bacteria 2816332141 2816515849 85
43 iso_pu_bacteria 2818991457 2819660639 85
44 iso_pu_bacteria 2842391507 2842394173 85
45 iso_pu_bacteria 2842757796 2842759742 85
46 iso_pu_bacteria 2842780639 2842781646 85
47 iso_pu_bacteria 2852649853 2852653103 85
48 iso_pu_bacteria 2852684882 2852688821 85
49 iso_pu_bacteria 2857442823 2857445087 85
50 iso_pu_bacteria 2874220319 2874220391 85
51 iso_pu_bacteria 2919089067 2919091661 85
52 iso_pu_bacteria 2919130084 2919130090 85
53 iso_pu_bacteria 2919134579 2919134932 85
54 iso_pu_bacteria 2919513703 2919515166 85
55 iso_pu_bacteria 2919675420 2919678183 85
56 iso_pu_bacteria 2923516293 2923519225 85
57 iso_pu_bacteria 2928496128 2928498481 85
58 iso_pu_bacteria 2929195423 2929198915 85
59 iso_pu_bacteria 2931380184 2931381952 85
60 iso_pu_bacteria 2937610967 2937611282 85
61 iso_pu_bacteria 2939589442 2939591862 85
62 iso_pu_bacteria 2939622612 2939625888 85
63 iso_pu_bacteria 2939626828 2939631017 85
64 iso_pu_bacteria 2941475908 2941477275 85
65 iso_pu_bacteria 2941489479 2941490073 85
66 iso_pu_bacteria 2961047084 2961047156 85
67 iso_pu_bacteria 2961064222 2961068526 85
68 iso_pu_bacteria 2974307012 2974309973 85
69 iso_pu_bacteria 2977247770 2977250708 85
70 iso_pu_bacteria 2984514374 2984514807 85
71 iso_pu_bacteria 2987605356 2987605651 85
72 iso_pu_bacteria 2995948881 2995950367 85
73 iso_pu_bacteria 8002869464 8002871448 85
74 iso_pu_bacteria 8003014200 8003014999 85
75 iso_pu_bacteria 8021622325 8021626347 85
76 iso_pu_bacteria 8021626552 8021629640 85
77 iso_pu_bacteria 8021648035 8021649681 85
78 3300036712 Ga0316584_0876177 Ga0316584_0876177_183_443 86
79 iso_pu_bacteria 2537561836 2538834128 86
80 iso_pu_bacteria 2593339238 2595448049 86
81 iso_pu_bacteria 2593339239 2595451345 86
82 iso_pu_bacteria 2643221562 2643829528 86
83 iso_pu_bacteria 2643221577 2643895217 86
84 iso_pu_bacteria 2643221685 2644477376 86
85 iso_pu_bacteria 2687453130 2687584037 86
86 iso_pu_bacteria 2718218334 2721028620 86
87 iso_pu_bacteria 2734482264 2735835789 86
88 iso_pu_bacteria 2738543009 2739227006 86
89 iso_pu_bacteria 2739367700 2739732120 86
90 iso_pu_bacteria 2818991440 2819566533 86
91 iso_pu_bacteria 2842914999 2842915005 86
92 iso_pu_bacteria 2842918807 2842922239 86
93 iso_pu_bacteria 2884338543 2884339567 86
94 iso_pu_bacteria 2884411467 2884413732 86
95 iso_pu_bacteria 2895395659 2895397478 86
96 iso_pu_bacteria 2904463128 2904467189 86
97 iso_pu_bacteria 2919085039 2919086796 86
98 iso_pu_bacteria 2919404418 2919404424 86
99 iso_pu_bacteria 2928963466 2928964818 86
100 iso_pu_bacteria 2939611941 2939612729 86
101 iso_pu_bacteria 2941471342 2941473847 86
102 iso_pu_bacteria 2953994433 2953997356 86
103 3300005563 Ga0068855_101096753 Ga0068855_1010967531 87
104 3300009093 Ga0105240_10029309 Ga0105240_100293092 87
105 3300041509 Ga0451843_0573241 Ga0451843_0573241_178_444 87
106 iso_pu_bacteria 2510065053 2510284513 87
107 iso_pu_bacteria 2510065055 2510296065 87
108 iso_pu_bacteria 2510065058 2510312304 87
109 iso_pu_bacteria 2511231002 2511244128 87
110 iso_pu_bacteria 2511231004 2511253623 87
111 iso_pu_bacteria 2511231006 2511264674 87
112 iso_pu_bacteria 2511231007 2511269485 87
113 iso_pu_bacteria 2511231008 2511276186 87
114 iso_pu_bacteria 2511231010 2511290545 87
115 iso_pu_bacteria 2511231011 2511296736 87
116 iso_pu_bacteria 2511231012 2511299315 87
117 iso_pu_bacteria 2511231014 2511312697 87
118 iso_pu_bacteria 2511231015 2511318186 87
119 iso_pu_bacteria 2511231016 2511325855 87
120 iso_pu_bacteria 2511231017 2511332008 87
121 iso_pu_bacteria 2511231018 2511339324 87
122 iso_pu_bacteria 2511231019 2511345373 87
123 iso_pu_bacteria 2511231020 2511353079 87
124 iso_pu_bacteria 2511231021 2511359681 87
125 iso_pu_bacteria 2511231022 2511364591 87
126 iso_pu_bacteria 2511231023 2511369306 87
127 iso_pu_bacteria 2511231024 2511373047 87
128 iso_pu_bacteria 2511231031 2511415618 87
129 iso_pu_bacteria 2511231156 2511827289 87
130 iso_pu_bacteria 2512047018 2512327914 87
131 iso_pu_bacteria 2513020051 2513231527 87
132 iso_pu_bacteria 2554235231 2555246664 87
133 iso_pu_bacteria 2554235341 2555672475 87
134 iso_pu_bacteria 2582580891 2583794822 87
135 iso_pu_bacteria 2597489887 2597860534 87
136 iso_pu_bacteria 2597489888 2597866287 87
137 iso_pu_bacteria 2597489889 2597872132 87
138 iso_pu_bacteria 2599185155 2599329238 87
139 iso_pu_bacteria 2599185160 2599358072 87
140 iso_pu_bacteria 2599185161 2599364435 87
141 iso_pu_bacteria 2599185162 2599371029 87
142 iso_pu_bacteria 2599185163 2599377051 87
143 iso_pu_bacteria 2599185164 2599383237 87
144 iso_pu_bacteria 2599185165 2599389684 87
145 iso_pu_bacteria 2599185166 2599395981 87
146 iso_pu_bacteria 2599185167 2599401226 87
147 iso_pu_bacteria 2599185168 2599407821 87
148 iso_pu_bacteria 2599185179 2599452955 87
149 iso_pu_bacteria 2599185181 2599464887 87
150 iso_pu_bacteria 2599185182 2599471212 87
151 iso_pu_bacteria 2599185185 2599486604 87
152 iso_pu_bacteria 2599185186 2599494198 87
153 iso_pu_bacteria 2599185188 2599505006 87
154 iso_pu_bacteria 2599185189 2599509704 87
155 iso_pu_bacteria 2599185190 2599516304 87
156 iso_pu_bacteria 2599185191 2599520117 87
157 iso_pu_bacteria 2599185212 2599615530 87
158 iso_pu_bacteria 2599185214 2599626688 87
159 iso_pu_bacteria 2599185226 2599675934 87
160 iso_pu_bacteria 2599185227 2599684225 87
161 iso_pu_bacteria 2599185229 2599696239 87
162 iso_pu_bacteria 2599185248 2599773748 87
163 iso_pu_bacteria 2599185257 2599807264 87
164 iso_pu_bacteria 2599185288 2599881560 87
165 iso_pu_bacteria 2599185289 2599889941 87
166 iso_pu_bacteria 2599185290 2599895724 87
167 iso_pu_bacteria 2599185291 2599901664 87
168 iso_pu_bacteria 2599185300 2599930566 87
169 iso_pu_bacteria 2599185302 2599944899 87
170 iso_pu_bacteria 2599185303 2599951924 87
171 iso_pu_bacteria 2599185304 2599955372 87
172 iso_pu_bacteria 2599185305 2599962781 87
173 iso_pu_bacteria 2599185306 2599967808 87
174 iso_pu_bacteria 2599185307 2599974000 87
175 iso_pu_bacteria 2599185308 2599978930 87
176 iso_pu_bacteria 2599185309 2599984104 87
177 iso_pu_bacteria 2599185310 2599990175 87
178 iso_pu_bacteria 2599185311 2599996933 87
179 iso_pu_bacteria 2599185312 2600001886 87
180 iso_pu_bacteria 2599185313 2600009196 87
181 iso_pu_bacteria 2599185314 2600012890 87
182 iso_pu_bacteria 2599185315 2600020744 87
183 iso_pu_bacteria 2599185316 2600025803 87
184 iso_pu_bacteria 2599185317 2600031017 87
185 iso_pu_bacteria 2599185318 2600038378 87
186 iso_pu_bacteria 2599185319 2600043710 87
187 iso_pu_bacteria 2599185320 2600048709 87
188 iso_pu_bacteria 2599185321 2600055524 87
189 iso_pu_bacteria 2599185322 2600061963 87
190 iso_pu_bacteria 2599185323 2600067203 87
191 iso_pu_bacteria 2599185324 2600073300 87
192 iso_pu_bacteria 2599185325 2600079848 87
193 iso_pu_bacteria 2599185356 2600217618 87
194 iso_pu_bacteria 2600254930 2600360992 87
195 iso_pu_bacteria 2600254931 2600367926 87
196 iso_pu_bacteria 2600254954 2600445347 87
197 iso_pu_bacteria 2600255283 2601628597 87
198 iso_pu_bacteria 2600255296 2601693775 87
199 iso_pu_bacteria 2600255313 2601777786 87
200 iso_pu_bacteria 2600255318 2601800647 87
201 iso_pu_bacteria 2600255389 2602007756 87
202 iso_pu_bacteria 2603880185 2606078544 87
203 iso_pu_bacteria 2603880199 2606125796 87
204 iso_pu_bacteria 2619619299 2621297177 87
205 iso_pu_bacteria 2623620443 2624483060 87
206 iso_pu_bacteria 2623620446 2624494592 87
207 iso_pu_bacteria 2643221565 2643845038 87
208 iso_pu_bacteria 2643221571 2643870766 87
209 iso_pu_bacteria 2643221589 2643957732 87
210 iso_pu_bacteria 2643221602 2644025848 87
211 iso_pu_bacteria 2643221628 2644163799 87
212 iso_pu_bacteria 2643221633 2644188204 87
213 iso_pu_bacteria 2643221650 2644286705 87
214 iso_pu_bacteria 2643221658 2644325939 87
215 iso_pu_bacteria 2643221672 2644397446 87
216 iso_pu_bacteria 2643221683 2644466322 87
217 iso_pu_bacteria 2643221713 2644621345 87
218 iso_pu_bacteria 2651869719 2652545259 87
219 iso_pu_bacteria 2667528170 2671094239 87
220 iso_pu_bacteria 2667528171 2671100609 87
221 iso_pu_bacteria 2667528176 2671129751 87
222 iso_pu_bacteria 2671180172 2671773175 87
223 iso_pu_bacteria 2675903420 2677899086 87
224 iso_pu_bacteria 2675903515 2678265801 87
225 iso_pu_bacteria 2713897148 2715752485 87
226 iso_pu_bacteria 2713897149 2715759236 87
227 iso_pu_bacteria 2718217725 2718636282 87
228 iso_pu_bacteria 2721755607 2723251023 87
229 iso_pu_bacteria 2728369097 2729145541 87
230 iso_pu_bacteria 2738541265 2738673081 87
231 iso_pu_bacteria 2738541271 2738690950 87
232 iso_pu_bacteria 2738541276 2738716721 87
233 iso_pu_bacteria 2738541277 2738723295 87
234 iso_pu_bacteria 2738541282 2738751474 87
235 iso_pu_bacteria 2738541294 2738810111 87
236 iso_pu_bacteria 2738541303 2738860515 87
237 iso_pu_bacteria 2738541307 2738885619 87
238 iso_pu_bacteria 2738541309 2738897471 87
239 iso_pu_bacteria 2738543004 2739200449 87
240 iso_pu_bacteria 2738543013 2739250957 87
241 iso_pu_bacteria 2738543015 2739262132 87
242 iso_pu_bacteria 2738543016 2739266913 87
243 iso_pu_bacteria 2738543019 2739284026 87
244 iso_pu_bacteria 2738543020 2739287272 87
245 iso_pu_bacteria 2738543021 2739292585 87
246 iso_pu_bacteria 2738543025 2739315015 87
247 iso_pu_bacteria 2740892503 2743740087 87
248 iso_pu_bacteria 2744054620 2745007035 87
249 iso_pu_bacteria 2765235841 2765586280 87
250 iso_pu_bacteria 2773857670 2774121961 87
251 iso_pu_bacteria 2773857672 2774129656 87
252 iso_pu_bacteria 2773857673 2774137204 87
253 iso_pu_bacteria 2784132063 2784262170 87
254 iso_pu_bacteria 2791355520 2794595128 87
255 iso_pu_bacteria 2806310737 2807410514 87
256 iso_pu_bacteria 2806310745 2807458859 87
257 iso_pu_bacteria 2808606361 2808858814 87
258 iso_pu_bacteria 2808606376 2808926145 87
259 iso_pu_bacteria 2808606377 2808932382 87
260 iso_pu_bacteria 2808606378 2808938641 87
261 iso_pu_bacteria 2808606379 2808941159 87
262 iso_pu_bacteria 2808606380 2808948246 87
263 iso_pu_bacteria 2808606381 2808954503 87
264 iso_pu_bacteria 2808606382 2808961319 87
265 iso_pu_bacteria 2808606383 2808967318 87
266 iso_pu_bacteria 2808606385 2808977432 87
267 iso_pu_bacteria 2808606388 2808992910 87
268 iso_pu_bacteria 2808606389 2809002167 87
269 iso_pu_bacteria 2808606445 2809219123 87
270 iso_pu_bacteria 2816332298 2817493705 87
271 iso_pu_bacteria 2818991446 2819601762 87
272 iso_pu_bacteria 2818991456 2819659358 87
273 iso_pu_bacteria 2818991464 2819706275 87
274 iso_pu_bacteria 2823421272 2823421969 87
275 iso_pu_bacteria 2825651385 2825655451 87
276 iso_pu_bacteria 2826581358 2826582760 87
277 iso_pu_bacteria 2831265667 2831268492 87
278 iso_pu_bacteria 2834028612 2834033100 87
279 iso_pu_bacteria 2838054893 2838061083 87
280 iso_pu_bacteria 2842677519 2842680699 87
281 iso_pu_bacteria 2842733646 2842737722 87
282 iso_pu_bacteria 2842747753 2842752899 87
283 iso_pu_bacteria 2842805378 2842808525 87
284 iso_pu_bacteria 2842815866 2842819787 87
285 iso_pu_bacteria 2842826826 2842828987 87
286 iso_pu_bacteria 2842832357 2842836817 87
287 iso_pu_bacteria 2842837860 2842840574 87
288 iso_pu_bacteria 2842843487 2842847554 87
289 iso_pu_bacteria 2842849001 2842852959 87
290 iso_pu_bacteria 2842854478 2842859236 87
291 iso_pu_bacteria 2844665904 2844666647 87
292 iso_pu_bacteria 2852612431 2852617994 87
293 iso_pu_bacteria 2852657418 2852661183 87
294 iso_pu_bacteria 2852667396 2852673052 87
295 iso_pu_bacteria 2860339153 2860344052 87
296 iso_pu_bacteria 2860867994 2860872684 87
297 iso_pu_bacteria 2878029506 2878034998 87
298 iso_pu_bacteria 2880230671 2880235640 87
299 iso_pu_bacteria 2881101125 2881102074 87
300 iso_pu_bacteria 2885192300 2885197556 87
301 iso_pu_bacteria 2885198086 2885200378 87
302 iso_pu_bacteria 2885211737 2885214031 87
303 iso_pu_bacteria 2899924645 2899927999 87
304 iso_pu_bacteria 2904449895 2904453053 87
305 iso_pu_bacteria 2904456579 2904459909 87
306 iso_pu_bacteria 2904518522 2904522499 87
307 iso_pu_bacteria 2904541872 2904549093 87
308 iso_pu_bacteria 2904550169 2904554206 87
309 iso_pu_bacteria 2908446538 2908452223 87
310 iso_pu_bacteria 2912963787 2912968552 87
311 iso_pu_bacteria 2913036834 2913042208 87
312 iso_pu_bacteria 2917070673 2917076358 87
313 iso_pu_bacteria 2917832318 2917834474 87
314 iso_pu_bacteria 2919063839 2919067624 87
315 iso_pu_bacteria 2919125081 2919127268 87
316 iso_pu_bacteria 2919155634 2919158584 87
317 iso_pu_bacteria 2919385768 2919390489 87
318 iso_pu_bacteria 2919456309 2919461590 87
319 iso_pu_bacteria 2919462493 2919463363 87
320 iso_pu_bacteria 2919481497 2919486033 87
321 iso_pu_bacteria 2919487758 2919492610 87
322 iso_pu_bacteria 2919501602 2919506264 87
323 iso_pu_bacteria 2919688452 2919691879 87
324 iso_pu_bacteria 2919697872 2919701292 87
325 iso_pu_bacteria 2923153595 2923159178 87
326 iso_pu_bacteria 2923586266 2923591156 87
327 iso_pu_bacteria 2926063275 2926068274 87
328 iso_pu_bacteria 2928037797 2928039934 87
329 iso_pu_bacteria 2928044640 2928047317 87
330 iso_pu_bacteria 2928051484 2928057479 87
331 iso_pu_bacteria 2928064002 2928068135 87
332 iso_pu_bacteria 2928070936 2928072720 87
333 iso_pu_bacteria 2928084124 2928085883 87
334 iso_pu_bacteria 2929144301 2929149594 87
335 iso_pu_bacteria 2929160207 2929160721 87
336 iso_pu_bacteria 2929189879 2929194796 87
337 iso_pu_bacteria 2929520902 2929526011 87
338 iso_pu_bacteria 2931369376 2931373000 87
339 iso_pu_bacteria 2931390751 2931396073 87
340 iso_pu_bacteria 2931396565 2931397716 87
341 iso_pu_bacteria 2935353572 2935359790 87
342 iso_pu_bacteria 2939636861 2939641980 87
343 iso_pu_bacteria 2939651529 2939654535 87
344 iso_pu_bacteria 2945909444 2945914783 87
345 iso_pu_bacteria 2945928738 2945931260 87
346 iso_pu_bacteria 2945945610 2945951151 87
347 iso_pu_bacteria 2945961074 2945966444 87
348 iso_pu_bacteria 2945972063 2945974191 87
349 iso_pu_bacteria 2945984333 2945989818 87
350 iso_pu_bacteria 2946006987 2946007297 87
351 iso_pu_bacteria 2946027586 2946033301 87
352 iso_pu_bacteria 2947233263 2947234077 87
353 iso_pu_bacteria 2954767861 2954769458 87
354 iso_pu_bacteria 2969304461 2969309825 87
355 iso_pu_bacteria 2974289157 2974294428 87
356 iso_pu_bacteria 2974298342 2974301943 87
357 iso_pu_bacteria 2974320154 2974321128 87
358 iso_pu_bacteria 2984286254 2984286970 87
359 iso_pu_bacteria 2984499530 2984500489 87
360 iso_pu_bacteria 2984504281 2984507003 87
361 iso_pu_bacteria 2988728565 2988731139 87
362 iso_pu_bacteria 2990196909 2990198263 87
363 iso_pu_bacteria 2998139840 2998145051 87
364 iso_pu_bacteria 3007252601 3007255609 87
365 iso_pu_bacteria 3007315729 3007320297 87
366 iso_pu_bacteria 3007395558 3007398825 87
367 iso_pu_bacteria 3007419365 3007425366 87
368 iso_pu_bacteria 3007511990 3007516843 87
369 iso_pu_bacteria 3007614139 3007617782 87
370 iso_pu_bacteria 3007619802 3007621570 87
371 iso_pu_bacteria 3007718800 3007721246 87
372 iso_pu_bacteria 3007803356 3007808960 87
373 iso_pu_bacteria 3007855910 3007860255 87
374 iso_pu_bacteria 3007861166 3007866512 87
375 iso_pu_bacteria 3007866637 3007867098 87
376 iso_pu_bacteria 3007872151 3007873902 87
377 iso_pu_bacteria 637000220 637322913 87
378 iso_pu_bacteria 640427133 640486746 87
379 iso_pu_bacteria 651053060 651174596 87
380 iso_pu_bacteria 8015687852 8015693266 87
381 iso_pu_bacteria 8016728285 8016730930 87
382 iso_pu_bacteria 8019769354 8019771163 87
383 iso_pu_bacteria 8019775933 8019780526 87
384 iso_pu_bacteria 8029995093 8029995845 87
385 iso_pu_bacteria 8034962539 8034966831 87
386 iso_pu_bacteria 8052494512 8052499495 87
387 iso_pu_bacteria 8054285046 8054290280 87
388 iso_pu_bacteria 8054347763 8054352862 87
389 iso_pu_bacteria 8054503363 8054508572 87
390 iso_pu_bacteria 8054929484 8054933495 87
391 iso_pu_bacteria 8055770955 8055776516 87
392 iso_pu_bacteria 8055817908 8055823547 87
393 iso_pu_bacteria 8055878733 8055880547 87
394 iso_pu_bacteria 8056115690 8056115807 87
395 iso_pu_bacteria 8056120720 8056121234 87
396 iso_pu_bacteria 8056125926 8056131260 87
397 iso_pu_bacteria 8056131705 8056136977 87
398 iso_pu_bacteria 8056137416 8056137951 87
399 iso_pu_bacteria 8056143049 8056148415 87
400 iso_pu_bacteria 8056148874 8056151835 87
401 iso_pu_bacteria 8056155041 8056156469 87
402 iso_pu_bacteria 8056161164 8056163272 87
403 iso_pu_bacteria 8056166840 8056171517 87
404 iso_pu_bacteria 8056172158 8056172186 87
405 iso_pu_bacteria 8056177738 8056179337 87
406 iso_pu_bacteria 8056569372 8056572099 87
407 iso_pu_bacteria 8057798959 8057803937 87
408 3300006051 Ga0075364_10006019 Ga0075364_100060197 88
409 3300013306 Ga0163162_13452503 Ga0163162_134525032 88
410 3300030745 Ga0316182_1450880 Ga0316182_14508801 88
411 3300031548 Ga0307408_100209542 Ga0307408_1002095423 88
412 3300031548 Ga0307408_101783485 Ga0307408_1017834851 88
413 3300031731 Ga0307405_10303349 Ga0307405_103033493 88
414 3300031824 Ga0307413_10156171 Ga0307413_101561712 88
415 3300031824 Ga0307413_10531235 Ga0307413_105312352 88
416 3300031901 Ga0307406_11120664 Ga0307406_111206641 88
417 3300031911 Ga0307412_10028293 Ga0307412_100282933 88
418 3300032002 Ga0307416_100298595 Ga0307416_1002985953 88
419 3300032004 Ga0307414_10007179 Ga0307414_100071797 88
420 3300032004 Ga0307414_10063463 Ga0307414_100634635 88
421 3300032004 Ga0307414_10353194 Ga0307414_103531942 88
422 3300032005 Ga0307411_10649612 Ga0307411_106496122 88
423 3300035695 Ga0373927_0042975 Ga0373927_0042975_863_1180 88
424 3300041456 Ga0451795_0151863 Ga0451795_0151863_653_922 88
425 3300041460 Ga0451802_1642252 Ga0451802_1642252_145_414 88
426 3300042876 Ga0451577_0000019 Ga0451577_0000019_207938_208219 88
427 3300044712 Ga0453684_0000057 Ga0453684_0000057_207861_208142 88
428 3300049127 Ga0501306_032209 Ga0501306_032209_462_728 88
429 3300049568 Ga0501031_0272582 Ga0501031_0272582_618_884 88
430 3300049570 Ga0501033_0004251 Ga0501033_0004251_10967_11233 88
431 3300049571 Ga0501034_0634627 Ga0501034_0634627_651_920 88
432 3300049824 Ga0501045_0222616 Ga0501045_0222616_858_1124 88
433 3300050491 nmdc:mga00v17_8118_c1 nmdc:mga00v17_8118_c1_3187_3453 88
434 2209111006 2214905765 2213963141 89
435 3300000043 ARcpr5yngRDRAFT_c016669 ARcpr5yngRDRAFT_0166692 89
436 3300001989 JGI24739J22299_10099229 JGI24739J22299_100992292 89
437 3300001990 JGI24737J22298_10092281 JGI24737J22298_100922812 89
438 3300002067 JGI24735J21928_10159064 JGI24735J21928_101590641 89
439 3300002074 JGI24748J21848_1024607 JGI24748J21848_10246072 89
440 3300002773 JGI25152J39213_1000284 JGI25152J39213_100028438 89
441 3300002774 JGI25150J39212_1000359 JGI25150J39212_10003596 89
442 3300002774 JGI25150J39212_1033873 JGI25150J39212_10338731 89
443 3300002987 JGI25159J45721_1024889 JGI25159J45721_10248893 89
444 3300003187 JGI25151J46595_10000895 JGI25151J46595_1000089530 89
445 3300003187 JGI25151J46595_10007643 JGI25151J46595_100076438 89
446 3300003187 JGI25151J46595_10034563 JGI25151J46595_100345632 89
447 3300003203 JGI25406J46586_10169214 JGI25406J46586_101692142 89
448 3300003215 JGI25153J46596_10000050 JGI25153J46596_10000050151 89
449 3300003215 JGI25153J46596_10058987 JGI25153J46596_100589873 89
450 3300003215 JGI25153J46596_10115215 JGI25153J46596_101152152 89
451 3300003323 rootH1_10017878 rootH1_100178782 89
452 3300003371 JGI26145J50221_1000107 JGI26145J50221_10001076 89
453 3300003382 JGI26139J50223_100830 JGI26139J50223_1008302 89
454 3300003392 JGI26134J50242_103769 JGI26134J50242_1037691 89
455 3300003400 JGI26131J50246_103152 JGI26131J50246_1031521 89
456 3300003502 JGI26143J51219_1000464 JGI26143J51219_10004643 89
457 3300003503 JGI26141J51220_1002450 JGI26141J51220_10024501 89
458 3300003504 JGI26138J51218_104514 JGI26138J51218_1045142 89
459 3300003771 Ga0055526_1005867 Ga0055526_10058676 89
460 3300003771 Ga0055526_1008536 Ga0055526_10085366 89
461 3300003771 Ga0055526_1008987 Ga0055526_10089876 89
462 3300003773 Ga0055537_1000851 Ga0055537_10008517 89
463 3300003773 Ga0055537_1001096 Ga0055537_10010966 89
464 3300003775 Ga0055524_1002940 Ga0055524_100294017 89
465 3300003775 Ga0055524_1003518 Ga0055524_10035182 89
466 3300003775 Ga0055524_1027470 Ga0055524_10274702 89
467 3300003781 Ga0055536_1012444 Ga0055536_10124441 89
468 3300003781 Ga0055536_1020462 Ga0055536_10204622 89
469 3300003781 Ga0055536_1065689 Ga0055536_10656892 89
470 3300003781 Ga0055536_1086074 Ga0055536_10860742 89
471 3300003784 Ga0055534_1000766 Ga0055534_10007666 89
472 3300003784 Ga0055534_1003331 Ga0055534_10033314 89
473 3300003784 Ga0055534_1009637 Ga0055534_10096372 89
474 3300003784 Ga0055534_1010410 Ga0055534_10104104 89
475 3300003790 Ga0055528_1001961 Ga0055528_10019617 89
476 3300003790 Ga0055528_1020733 Ga0055528_10207332 89
477 3300003790 Ga0055528_1029995 Ga0055528_10299952 89
478 3300003791 Ga0055530_10004966 Ga0055530_100049668 89
479 3300003791 Ga0055530_10029773 Ga0055530_100297732 89
480 3300003792 Ga0055540_1006952 Ga0055540_10069528 89
481 3300003792 Ga0055540_1022881 Ga0055540_10228812 89
482 3300003794 Ga0055531_10014020 Ga0055531_100140207 89
483 3300003794 Ga0055531_10027931 Ga0055531_100279312 89
484 3300003794 Ga0055531_10034155 Ga0055531_100341551 89
485 3300003794 Ga0055531_10088353 Ga0055531_100883532 89
486 3300003856 Ga0058692_1000748 Ga0058692_10007486 89
487 3300003856 Ga0058692_1000785 Ga0058692_10007856 89
488 3300004785 Ga0058858_1021436 Ga0058858_10214363 89
489 3300004800 Ga0058861_11994669 Ga0058861_119946691 89
490 3300004801 Ga0058860_10042416 Ga0058860_100424163 89
491 3300004803 Ga0058862_12785357 Ga0058862_127853572 89
492 3300005277 Ga0065716_1007133 Ga0065716_10071332 89
493 3300005277 Ga0065716_1013521 Ga0065716_10135211 89
494 3300005288 Ga0065714_10008398 Ga0065714_100083989 89
495 3300005288 Ga0065714_10358924 Ga0065714_103589241 89
496 3300005289 Ga0065704_10025805 Ga0065704_100258052 89
497 3300005289 Ga0065704_10071563 Ga0065704_1007156317 89
498 3300005289 Ga0065704_10118559 Ga0065704_101185591 89
499 3300005289 Ga0065704_10188262 Ga0065704_101882623 89
500 3300005289 Ga0065704_10643093 Ga0065704_106430932 89
501 3300005290 Ga0065712_10053095 Ga0065712_100530951 89
502 3300005293 Ga0065715_10035747 Ga0065715_100357471 89
503 3300005293 Ga0065715_10077491 Ga0065715_100774912 89
504 3300005293 Ga0065715_10291245 Ga0065715_102912453 89
505 3300005293 Ga0065715_10476019 Ga0065715_104760192 89
506 3300005293 Ga0065715_10827400 Ga0065715_108274002 89
507 3300005293 Ga0065715_11111098 Ga0065715_111110981 89
508 3300005327 Ga0070658_10259540 Ga0070658_102595402 89
509 3300005328 Ga0070676_10105815 Ga0070676_101058152 89
510 3300005329 Ga0070683_101644216 Ga0070683_1016442162 89
511 3300005330 Ga0070690_100205964 Ga0070690_1002059643 89
512 3300005330 Ga0070690_100461122 Ga0070690_1004611223 89
513 3300005331 Ga0070670_100015496 Ga0070670_1000154963 89
514 3300005331 Ga0070670_100127224 Ga0070670_1001272242 89
515 3300005331 Ga0070670_100398642 Ga0070670_1003986422 89
516 3300005331 Ga0070670_101455527 Ga0070670_1014555272 89
517 3300005333 Ga0070677_10301205 Ga0070677_103012052 89
518 3300005333 Ga0070677_10353843 Ga0070677_103538432 89
519 3300005334 Ga0068869_100194973 Ga0068869_1001949733 89
520 3300005334 Ga0068869_100978594 Ga0068869_1009785941 89
521 3300005336 Ga0070680_100435181 Ga0070680_1004351813 89
522 3300005336 Ga0070680_100492363 Ga0070680_1004923632 89
523 3300005337 Ga0070682_100099706 Ga0070682_1000997063 89
524 3300005339 Ga0070660_100058257 Ga0070660_1000582575 89
525 3300005340 Ga0070689_100050593 Ga0070689_1000505931 89
526 3300005344 Ga0070661_100501530 Ga0070661_1005015302 89
527 3300005344 Ga0070661_100620413 Ga0070661_1006204132 89
528 3300005345 Ga0070692_10177043 Ga0070692_101770431 89
529 3300005347 Ga0070668_100131613 Ga0070668_1001316134 89
530 3300005347 Ga0070668_100152536 Ga0070668_1001525363 89
531 3300005347 Ga0070668_100329946 Ga0070668_1003299463 89
532 3300005347 Ga0070668_102059175 Ga0070668_1020591752 89
533 3300005353 Ga0070669_100049915 Ga0070669_1000499152 89
534 3300005353 Ga0070669_100267140 Ga0070669_1002671403 89
535 3300005353 Ga0070669_101181107 Ga0070669_1011811071 89
536 3300005354 Ga0070675_100105895 Ga0070675_1001058955 89
537 3300005354 Ga0070675_100851346 Ga0070675_1008513461 89
538 3300005354 Ga0070675_100952268 Ga0070675_1009522682 89
539 3300005354 Ga0070675_101908030 Ga0070675_1019080301 89
540 3300005355 Ga0070671_100012931 Ga0070671_1000129319 89
541 3300005355 Ga0070671_100627745 Ga0070671_1006277452 89
542 3300005355 Ga0070671_101903479 Ga0070671_1019034791 89
543 3300005356 Ga0070674_100103259 Ga0070674_1001032592 89
544 3300005356 Ga0070674_101449567 Ga0070674_1014495672 89
545 3300005364 Ga0070673_100046662 Ga0070673_1000466624 89
546 3300005364 Ga0070673_100491725 Ga0070673_1004917252 89
547 3300005364 Ga0070673_102040142 Ga0070673_1020401421 89
548 3300005365 Ga0070688_100175493 Ga0070688_1001754933 89
549 3300005366 Ga0070659_100843307 Ga0070659_1008433071 89
550 3300005367 Ga0070667_100889603 Ga0070667_1008896032 89
551 3300005367 Ga0070667_100937059 Ga0070667_1009370592 89
552 3300005438 Ga0070701_10090109 Ga0070701_100901092 89
553 3300005441 Ga0070700_100646238 Ga0070700_1006462382 89
554 3300005441 Ga0070700_101078180 Ga0070700_1010781801 89
555 3300005455 Ga0070663_100073683 Ga0070663_1000736832 89
556 3300005455 Ga0070663_100734984 Ga0070663_1007349841 89
557 3300005455 Ga0070663_102105856 Ga0070663_1021058562 89
558 3300005456 Ga0070678_100145207 Ga0070678_1001452073 89
559 3300005456 Ga0070678_100154201 Ga0070678_1001542013 89
560 3300005457 Ga0070662_100504078 Ga0070662_1005040783 89
561 3300005457 Ga0070662_100864428 Ga0070662_1008644281 89
562 3300005457 Ga0070662_100950323 Ga0070662_1009503232 89
563 3300005459 Ga0068867_100047984 Ga0068867_1000479843 89
564 3300005459 Ga0068867_101174500 Ga0068867_1011745002 89
565 3300005459 Ga0068867_101392403 Ga0068867_1013924032 89
566 3300005466 Ga0070685_10602475 Ga0070685_106024752 89
567 3300005530 Ga0070679_100193566 Ga0070679_1001935663 89
568 3300005539 Ga0068853_100023635 Ga0068853_1000236358 89
569 3300005539 Ga0068853_100035785 Ga0068853_1000357853 89
570 3300005539 Ga0068853_100046419 Ga0068853_1000464199 89
571 3300005539 Ga0068853_100291016 Ga0068853_1002910162 89
572 3300005539 Ga0068853_100298127 Ga0068853_1002981273 89
573 3300005539 Ga0068853_100413685 Ga0068853_1004136852 89
574 3300005543 Ga0070672_100087779 Ga0070672_1000877794 89
575 3300005543 Ga0070672_100212901 Ga0070672_1002129014 89
576 3300005543 Ga0070672_100225826 Ga0070672_1002258263 89
577 3300005543 Ga0070672_101302427 Ga0070672_1013024272 89
578 3300005544 Ga0070686_100881416 Ga0070686_1008814162 89
579 3300005544 Ga0070686_101108696 Ga0070686_1011086961 89
580 3300005547 Ga0070693_100016180 Ga0070693_1000161807 89
581 3300005548 Ga0070665_100016134 Ga0070665_10001613417 89
582 3300005548 Ga0070665_100123654 Ga0070665_1001236546 89
583 3300005548 Ga0070665_100746984 Ga0070665_1007469842 89
584 3300005548 Ga0070665_102256177 Ga0070665_1022561772 89
585 3300005548 Ga0070665_102476277 Ga0070665_1024762772 89
586 3300005563 Ga0068855_100085311 Ga0068855_1000853112 89
587 3300005563 Ga0068855_100135916 Ga0068855_1001359162 89
588 3300005563 Ga0068855_100253283 Ga0068855_1002532832 89
589 3300005564 Ga0070664_100883766 Ga0070664_1008837662 89
590 3300005564 Ga0070664_101553696 Ga0070664_1015536962 89
591 3300005564 Ga0070664_101907626 Ga0070664_1019076261 89
592 3300005577 Ga0068857_100195794 Ga0068857_1001957942 89
593 3300005577 Ga0068857_102075867 Ga0068857_1020758672 89
594 3300005578 Ga0068854_100194243 Ga0068854_1001942432 89
595 3300005578 Ga0068854_100984875 Ga0068854_1009848752 89
596 3300005616 Ga0068852_100170516 Ga0068852_1001705162 89
597 3300005616 Ga0068852_100709206 Ga0068852_1007092062 89
598 3300005616 Ga0068852_100793939 Ga0068852_1007939392 89
599 3300005616 Ga0068852_100879035 Ga0068852_1008790352 89
600 3300005616 Ga0068852_102127081 Ga0068852_1021270811 89
601 3300005617 Ga0068859_101149424 Ga0068859_1011494242 89
602 3300005618 Ga0068864_100069812 Ga0068864_1000698125 89
603 3300005618 Ga0068864_101817926 Ga0068864_1018179262 89
604 3300005719 Ga0068861_100623202 Ga0068861_1006232023 89
605 3300005719 Ga0068861_101767812 Ga0068861_1017678122 89
606 3300005834 Ga0068851_10074443 Ga0068851_100744432 89
607 3300005834 Ga0068851_10704232 Ga0068851_107042321 89
608 3300005840 Ga0068870_10948038 Ga0068870_109480382 89
609 3300005841 Ga0068863_100032278 Ga0068863_1000322784 89
610 3300005841 Ga0068863_100058336 Ga0068863_1000583369 89
611 3300005841 Ga0068863_100411508 Ga0068863_1004115082 89
612 3300005843 Ga0068860_100719396 Ga0068860_1007193962 89
613 3300005844 Ga0068862_101881665 Ga0068862_1018816652 89
614 3300005844 Ga0068862_102325389 Ga0068862_1023253892 89
615 3300005985 Ga0081539_10024522 Ga0081539_100245227 89
616 3300005985 Ga0081539_10289846 Ga0081539_102898462 89
617 3300006038 Ga0075365_10024324 Ga0075365_100243243 89
618 3300006038 Ga0075365_10072215 Ga0075365_100722152 89
619 3300006042 Ga0075368_10445753 Ga0075368_104457532 89
620 3300006048 Ga0075363_100137748 Ga0075363_1001377482 89
621 3300006048 Ga0075363_100603747 Ga0075363_1006037471 89
622 3300006051 Ga0075364_10312945 Ga0075364_103129452 89
623 3300006051 Ga0075364_10969094 Ga0075364_109690941 89
624 3300006163 Ga0070715_10175421 Ga0070715_101754212 89
625 3300006177 Ga0075362_10356459 Ga0075362_103564592 89
626 3300006178 Ga0075367_10066635 Ga0075367_100666353 89
627 3300006186 Ga0075369_10038431 Ga0075369_100384312 89
628 3300006186 Ga0075369_10143950 Ga0075369_101439502 89
629 3300006195 Ga0075366_10418269 Ga0075366_104182693 89
630 3300006353 Ga0075370_10383044 Ga0075370_103830442 89
631 3300006353 Ga0075370_10794383 Ga0075370_107943832 89
632 3300006358 Ga0068871_100669295 Ga0068871_1006692953 89
633 3300006358 Ga0068871_100721204 Ga0068871_1007212042 89
634 3300006847 Ga0075431_101456190 Ga0075431_1014561902 89
635 3300006847 Ga0075431_101540001 Ga0075431_1015400012 89
636 3300006881 Ga0068865_100234304 Ga0068865_1002343043 89
637 3300006881 Ga0068865_101111409 Ga0068865_1011114092 89
638 3300006931 Ga0097620_101149436 Ga0097620_1011494362 89
639 3300006948 Ga0099826_10102560 Ga0099826_101025602 89
640 3300009011 Ga0105251_10003747 Ga0105251_1000374719 89
641 3300009011 Ga0105251_10018245 Ga0105251_100182457 89
642 3300009036 Ga0105244_10014959 Ga0105244_100149593 89
643 3300009036 Ga0105244_10103162 Ga0105244_101031623 89
644 3300009092 Ga0105250_10384358 Ga0105250_103843582 89
645 3300009092 Ga0105250_10506389 Ga0105250_105063892 89
646 3300009094 Ga0111539_10533653 Ga0111539_105336532 89
647 3300009094 Ga0111539_11863773 Ga0111539_118637732 89
648 3300009101 Ga0105247_10521638 Ga0105247_105216382 89
649 3300009147 Ga0114129_12250344 Ga0114129_122503442 89
650 3300009148 Ga0105243_10036695 Ga0105243_100366952 89
651 3300009148 Ga0105243_10063811 Ga0105243_100638112 89
652 3300009148 Ga0105243_10513432 Ga0105243_105134323 89
653 3300009148 Ga0105243_12842080 Ga0105243_128420801 89
654 3300009174 Ga0105241_10896043 Ga0105241_108960431 89
655 3300009174 Ga0105241_10937519 Ga0105241_109375192 89
656 3300009176 Ga0105242_10409436 Ga0105242_104094362 89
657 3300009176 Ga0105242_11870150 Ga0105242_118701502 89
658 3300009176 Ga0105242_12111774 Ga0105242_121117742 89
659 3300009177 Ga0105248_10497936 Ga0105248_104979363 89
660 3300009177 Ga0105248_10785422 Ga0105248_107854222 89
661 3300009177 Ga0105248_11868210 Ga0105248_118682102 89
662 3300009545 Ga0105237_10331902 Ga0105237_103319022 89
663 3300009545 Ga0105237_12749061 Ga0105237_127490611 89
664 3300009551 Ga0105238_10580839 Ga0105238_105808392 89
665 3300009551 Ga0105238_10859640 Ga0105238_108596401 89
666 3300009553 Ga0105249_12794200 Ga0105249_127942001 89
667 3300009978 Ga0105148_104783 Ga0105148_1047832 89
668 3300009979 Ga0105032_103281 Ga0105032_1032813 89
669 3300009984 Ga0105029_100378 Ga0105029_1003782 89
670 3300009986 Ga0105033_115349 Ga0105033_1153492 89
671 3300010375 Ga0105239_10053763 Ga0105239_100537637 89
672 3300010375 Ga0105239_10072506 Ga0105239_100725063 89
673 3300010375 Ga0105239_10865749 Ga0105239_108657492 89
674 3300010375 Ga0105239_12879247 Ga0105239_128792472 89
675 3300012475 Ga0157317_1000375 Ga0157317_10003752 89
676 3300012475 Ga0157317_1016544 Ga0157317_10165442 89
677 3300012476 Ga0157344_1002139 Ga0157344_10021392 89
678 3300012478 Ga0157328_1005054 Ga0157328_10050541 89
679 3300012480 Ga0157346_1001495 Ga0157346_10014952 89
680 3300012482 Ga0157318_1000454 Ga0157318_10004544 89
681 3300012482 Ga0157318_1000586 Ga0157318_10005861 89
682 3300012483 Ga0157337_1002148 Ga0157337_10021482 89
683 3300012483 Ga0157337_1005879 Ga0157337_10058792 89
684 3300012483 Ga0157337_1039178 Ga0157337_10391782 89
685 3300012485 Ga0157325_1003419 Ga0157325_10034192 89
686 3300012487 Ga0157321_1005337 Ga0157321_10053372 89
687 3300012488 Ga0157343_1000309 Ga0157343_10003093 89
688 3300012488 Ga0157343_1013361 Ga0157343_10133612 89
689 3300012490 Ga0157322_1006598 Ga0157322_10065981 89
690 3300012491 Ga0157329_1003027 Ga0157329_10030272 89
691 3300012491 Ga0157329_1042870 Ga0157329_10428701 89
692 3300012492 Ga0157335_1009945 Ga0157335_10099452 89
693 3300012494 Ga0157341_1014564 Ga0157341_10145642 89
694 3300012495 Ga0157323_1001577 Ga0157323_10015773 89
695 3300012497 Ga0157319_1001759 Ga0157319_10017592 89
696 3300012497 Ga0157319_1017527 Ga0157319_10175271 89
697 3300012497 Ga0157319_1035886 Ga0157319_10358862 89
698 3300012498 Ga0157345_1004272 Ga0157345_10042722 89
699 3300012500 Ga0157314_1003532 Ga0157314_10035322 89
700 3300012500 Ga0157314_1003888 Ga0157314_10038882 89
701 3300012505 Ga0157339_1007725 Ga0157339_10077252 89
702 3300012505 Ga0157339_1030069 Ga0157339_10300692 89
703 3300012506 Ga0157324_1005105 Ga0157324_10051052 89
704 3300012506 Ga0157324_1011096 Ga0157324_10110962 89
705 3300012508 Ga0157315_1001215 Ga0157315_10012153 89
706 3300012510 Ga0157316_1000423 Ga0157316_10004232 89
707 3300012510 Ga0157316_1001459 Ga0157316_10014593 89
708 3300012510 Ga0157316_1052548 Ga0157316_10525481 89
709 3300012512 Ga0157327_1058496 Ga0157327_10584962 89
710 3300012513 Ga0157326_1006150 Ga0157326_10061502 89
711 3300012515 Ga0157338_1000253 Ga0157338_10002537 89
712 3300013102 Ga0157371_10099791 Ga0157371_100997914 89
713 3300013102 Ga0157371_10612843 Ga0157371_106128432 89
714 3300013102 Ga0157371_11490750 Ga0157371_114907502 89
715 3300013104 Ga0157370_10282120 Ga0157370_102821202 89
716 3300013104 Ga0157370_10327837 Ga0157370_103278372 89
717 3300013104 Ga0157370_10340959 Ga0157370_103409593 89
718 3300013105 Ga0157369_10421157 Ga0157369_104211572 89
719 3300013297 Ga0157378_10023199 Ga0157378_100231999 89
720 3300013297 Ga0157378_12490850 Ga0157378_124908502 89
721 3300013306 Ga0163162_12354844 Ga0163162_123548442 89
722 3300013306 Ga0163162_12731804 Ga0163162_127318042 89
723 3300013307 Ga0157372_10093730 Ga0157372_100937305 89
724 3300013307 Ga0157372_10751529 Ga0157372_107515292 89
725 3300013308 Ga0157375_10340510 Ga0157375_103405102 89
726 3300013308 Ga0157375_10602389 Ga0157375_106023892 89
727 3300013308 Ga0157375_10658115 Ga0157375_106581152 89
728 3300014326 Ga0157380_10454896 Ga0157380_104548963 89
729 3300014326 Ga0157380_12272442 Ga0157380_122724421 89
730 3300014326 Ga0157380_12754044 Ga0157380_127540442 89
731 3300014497 Ga0182008_10123612 Ga0182008_101236122 89
732 3300014497 Ga0182008_10141939 Ga0182008_101419393 89
733 3300014497 Ga0182008_10929877 Ga0182008_109298771 89
734 3300014745 Ga0157377_10197807 Ga0157377_101978071 89
735 3300014968 Ga0157379_10283114 Ga0157379_102831142 89
736 3300014969 Ga0157376_11717232 Ga0157376_117172321 89
737 3300015261 Ga0182006_1028641 Ga0182006_10286412 89
738 3300015261 Ga0182006_1162819 Ga0182006_11628192 89
739 3300015265 Ga0182005_1055144 Ga0182005_10551442 89
740 3300015689 Ga0183360_10001 Ga0183360_100012724 89
741 3300017792 Ga0163161_10190066 Ga0163161_101900663 89
742 3300017792 Ga0163161_10262781 Ga0163161_102627812 89
743 3300025245 Ga0207425_1000117 Ga0207425_100011738 89
744 3300025245 Ga0207425_1015555 Ga0207425_10155551 89
745 3300025245 Ga0207425_1053279 Ga0207425_10532792 89
746 3300025258 Ga0209129_1000011 Ga0209129_1000011343 89
747 3300025263 Ga0209565_1000001 Ga0209565_10000011149 89
748 3300025263 Ga0209565_1000415 Ga0209565_100041540 89
749 3300025273 Ga0209673_1000001 Ga0209673_10000011149 89
750 3300025273 Ga0209673_1000204 Ga0209673_100020420 89
751 3300025273 Ga0209673_1002116 Ga0209673_100211621 89
752 3300025273 Ga0209673_1084364 Ga0209673_10843642 89
753 3300025284 Ga0209130_1003085 Ga0209130_100308510 89
754 3300025284 Ga0209130_1007816 Ga0209130_10078163 89
755 3300025291 Ga0209675_1000001 Ga0209675_10000011384 89
756 3300025291 Ga0209675_1000015 Ga0209675_100001561 89
757 3300025291 Ga0209675_1006904 Ga0209675_10069043 89
758 3300025292 Ga0209676_1000110 Ga0209676_10001107 89
759 3300025292 Ga0209676_1000156 Ga0209676_10001567 89
760 3300025292 Ga0209676_1001608 Ga0209676_100160827 89
761 3300025292 Ga0209676_1004379 Ga0209676_100437914 89
762 3300025292 Ga0209676_1004892 Ga0209676_10048926 89
763 3300025292 Ga0209676_1006351 Ga0209676_10063518 89
764 3300025294 Ga0209025_1000002 Ga0209025_1000002455 89
765 3300025294 Ga0209025_1000006 Ga0209025_100000619 89
766 3300025294 Ga0209025_1038555 Ga0209025_10385552 89
767 3300025295 Ga0209564_1000001 Ga0209564_10000011546 89
768 3300025295 Ga0209564_1000037 Ga0209564_1000037307 89
769 3300025295 Ga0209564_1007141 Ga0209564_10071417 89
770 3300025297 Ga0209758_1000003 Ga0209758_1000003462 89
771 3300025297 Ga0209758_1035768 Ga0209758_10357682 89
772 3300025297 Ga0209758_1044980 Ga0209758_10449803 89
773 3300025298 Ga0209050_1001128 Ga0209050_100112836 89
774 3300025298 Ga0209050_1016634 Ga0209050_10166346 89
775 3300025298 Ga0209050_1025712 Ga0209050_10257121 89
776 3300025299 Ga0209256_1000002 Ga0209256_10000027 89
777 3300025299 Ga0209256_1003821 Ga0209256_10038217 89
778 3300025299 Ga0209256_1007814 Ga0209256_10078146 89
779 3300025303 Ga0209051_1001513 Ga0209051_100151326 89
780 3300025303 Ga0209051_1026209 Ga0209051_10262092 89
781 3300025303 Ga0209051_1034215 Ga0209051_10342154 89
782 3300025304 Ga0209257_1000129 Ga0209257_10001297 89
783 3300025304 Ga0209257_1002665 Ga0209257_100266524 89
784 3300025304 Ga0209257_1005259 Ga0209257_10052597 89
785 3300025304 Ga0209257_1006382 Ga0209257_100638213 89
786 3300025304 Ga0209257_1006637 Ga0209257_10066376 89
787 3300025304 Ga0209257_1101832 Ga0209257_11018322 89
788 3300025315 Ga0207697_10131098 Ga0207697_101310982 89
789 3300025315 Ga0207697_10280361 Ga0207697_102803612 89
790 3300025321 Ga0207656_10061049 Ga0207656_100610492 89
791 3300025321 Ga0207656_10484483 Ga0207656_104844832 89
792 3300025711 Ga0207696_1211161 Ga0207696_12111612 89
793 3300025728 Ga0207655_1085698 Ga0207655_10856982 89
794 3300025735 Ga0207713_1000294 Ga0207713_100029440 89
795 3300025735 Ga0207713_1004451 Ga0207713_100445114 89
796 3300025893 Ga0207682_10340283 Ga0207682_103402832 89
797 3300025903 Ga0207680_10361413 Ga0207680_103614133 89
798 3300025904 Ga0207647_10165569 Ga0207647_101655692 89
799 3300025907 Ga0207645_10151261 Ga0207645_101512612 89
800 3300025908 Ga0207643_10104227 Ga0207643_101042274 89
801 3300025909 Ga0207705_10016228 Ga0207705_100162282 89
802 3300025909 Ga0207705_10265294 Ga0207705_102652942 89
803 3300025911 Ga0207654_10320367 Ga0207654_103203672 89
804 3300025912 Ga0207707_10772304 Ga0207707_107723042 89
805 3300025914 Ga0207671_10419190 Ga0207671_104191902 89
806 3300025917 Ga0207660_10119645 Ga0207660_101196453 89
807 3300025917 Ga0207660_10579106 Ga0207660_105791062 89
808 3300025918 Ga0207662_10496826 Ga0207662_104968262 89
809 3300025919 Ga0207657_10006384 Ga0207657_100063847 89
810 3300025920 Ga0207649_10247664 Ga0207649_102476643 89
811 3300025920 Ga0207649_10409589 Ga0207649_104095892 89
812 3300025921 Ga0207652_10104588 Ga0207652_101045885 89
813 3300025923 Ga0207681_10074212 Ga0207681_100742123 89
814 3300025923 Ga0207681_11613591 Ga0207681_116135912 89
815 3300025924 Ga0207694_10424882 Ga0207694_104248823 89
816 3300025924 Ga0207694_10648024 Ga0207694_106480241 89
817 3300025924 Ga0207694_11863754 Ga0207694_118637542 89
818 3300025925 Ga0207650_10004000 Ga0207650_100040007 89
819 3300025925 Ga0207650_10023595 Ga0207650_100235956 89
820 3300025925 Ga0207650_10311221 Ga0207650_103112213 89
821 3300025925 Ga0207650_10511625 Ga0207650_105116253 89
822 3300025926 Ga0207659_11050012 Ga0207659_110500122 89
823 3300025926 Ga0207659_11516365 Ga0207659_115163651 89
824 3300025926 Ga0207659_11684420 Ga0207659_116844202 89
825 3300025929 Ga0207664_10459231 Ga0207664_104592312 89
826 3300025931 Ga0207644_10004894 Ga0207644_100048947 89
827 3300025931 Ga0207644_10011422 Ga0207644_100114227 89
828 3300025931 Ga0207644_10704874 Ga0207644_107048742 89
829 3300025933 Ga0207706_10375392 Ga0207706_103753923 89
830 3300025933 Ga0207706_11426694 Ga0207706_114266942 89
831 3300025934 Ga0207686_10132394 Ga0207686_101323942 89
832 3300025934 Ga0207686_11352752 Ga0207686_113527522 89
833 3300025935 Ga0207709_10000421 Ga0207709_1000042126 89
834 3300025935 Ga0207709_10044385 Ga0207709_100443855 89
835 3300025936 Ga0207670_10524637 Ga0207670_105246371 89
836 3300025936 Ga0207670_10564024 Ga0207670_105640243 89
837 3300025937 Ga0207669_10076663 Ga0207669_100766634 89
838 3300025937 Ga0207669_10482142 Ga0207669_104821423 89
839 3300025937 Ga0207669_11205953 Ga0207669_112059531 89
840 3300025937 Ga0207669_11785760 Ga0207669_117857602 89
841 3300025938 Ga0207704_11103507 Ga0207704_111035072 89
842 3300025940 Ga0207691_10076483 Ga0207691_100764832 89
843 3300025940 Ga0207691_10092896 Ga0207691_100928963 89
844 3300025940 Ga0207691_10107616 Ga0207691_101076163 89
845 3300025940 Ga0207691_10205416 Ga0207691_102054162 89
846 3300025940 Ga0207691_10866756 Ga0207691_108667561 89
847 3300025941 Ga0207711_10073580 Ga0207711_100735802 89
848 3300025941 Ga0207711_10375480 Ga0207711_103754802 89
849 3300025942 Ga0207689_10034156 Ga0207689_100341563 89
850 3300025945 Ga0207679_10233122 Ga0207679_102331222 89
851 3300025949 Ga0207667_10058488 Ga0207667_100584882 89
852 3300025949 Ga0207667_10263845 Ga0207667_102638452 89
853 3300025960 Ga0207651_10024704 Ga0207651_100247049 89
854 3300025960 Ga0207651_10694860 Ga0207651_106948602 89
855 3300025960 Ga0207651_10997551 Ga0207651_109975512 89
856 3300025960 Ga0207651_11796811 Ga0207651_117968112 89
857 3300025972 Ga0207668_10013075 Ga0207668_100130753 89
858 3300025972 Ga0207668_10028680 Ga0207668_100286802 89
859 3300025972 Ga0207668_10071707 Ga0207668_100717074 89
860 3300025972 Ga0207668_10799855 Ga0207668_107998552 89
861 3300025972 Ga0207668_11130065 Ga0207668_111300652 89
862 3300025981 Ga0207640_10238713 Ga0207640_102387132 89
863 3300025981 Ga0207640_10867254 Ga0207640_108672542 89
864 3300025981 Ga0207640_11401481 Ga0207640_114014812 89
865 3300025981 Ga0207640_11421433 Ga0207640_114214332 89
866 3300025986 Ga0207658_10054967 Ga0207658_100549672 89
867 3300025986 Ga0207658_10784915 Ga0207658_107849152 89
868 3300025986 Ga0207658_11163925 Ga0207658_111639252 89
869 3300025986 Ga0207658_11786739 Ga0207658_117867392 89
870 3300026023 Ga0207677_10213528 Ga0207677_102135282 89
871 3300026041 Ga0207639_10001149 Ga0207639_1000114927 89
872 3300026041 Ga0207639_10016511 Ga0207639_100165115 89
873 3300026041 Ga0207639_10291906 Ga0207639_102919063 89
874 3300026041 Ga0207639_10427535 Ga0207639_104275352 89
875 3300026041 Ga0207639_10686551 Ga0207639_106865513 89
876 3300026041 Ga0207639_10964200 Ga0207639_109642002 89
877 3300026041 Ga0207639_11258627 Ga0207639_112586272 89
878 3300026041 Ga0207639_11456762 Ga0207639_114567622 89
879 3300026067 Ga0207678_10224274 Ga0207678_102242742 89
880 3300026067 Ga0207678_10253637 Ga0207678_102536372 89
881 3300026075 Ga0207708_10043595 Ga0207708_100435952 89
882 3300026088 Ga0207641_10092373 Ga0207641_100923732 89
883 3300026088 Ga0207641_10237001 Ga0207641_102370012 89
884 3300026088 Ga0207641_10307188 Ga0207641_103071882 89
885 3300026088 Ga0207641_11116756 Ga0207641_111167561 89
886 3300026089 Ga0207648_10208985 Ga0207648_102089853 89
887 3300026089 Ga0207648_10848325 Ga0207648_108483253 89
888 3300026089 Ga0207648_11416717 Ga0207648_114167172 89
889 3300026089 Ga0207648_11485189 Ga0207648_114851892 89
890 3300026089 Ga0207648_11799558 Ga0207648_117995582 89
891 3300026095 Ga0207676_10059226 Ga0207676_100592262 89
892 3300026095 Ga0207676_10500606 Ga0207676_105006063 89
893 3300026095 Ga0207676_11050458 Ga0207676_110504582 89
894 3300026116 Ga0207674_10071985 Ga0207674_100719859 89
895 3300026116 Ga0207674_11165838 Ga0207674_111658382 89
896 3300026116 Ga0207674_11882095 Ga0207674_118820951 89
897 3300026116 Ga0207674_12284306 Ga0207674_122843062 89
898 3300026118 Ga0207675_100475143 Ga0207675_1004751432 89
899 3300026118 Ga0207675_100708954 Ga0207675_1007089543 89
900 3300026118 Ga0207675_101318555 Ga0207675_1013185552 89
901 3300026121 Ga0207683_10139250 Ga0207683_101392503 89
902 3300026121 Ga0207683_10154461 Ga0207683_101544612 89
903 3300026121 Ga0207683_10668429 Ga0207683_106684292 89
904 3300026121 Ga0207683_10757420 Ga0207683_107574202 89
905 3300026142 Ga0207698_10050100 Ga0207698_100501002 89
906 3300026142 Ga0207698_10196978 Ga0207698_101969782 89
907 3300026142 Ga0207698_10996304 Ga0207698_109963042 89
908 3300026142 Ga0207698_11008429 Ga0207698_110084292 89
909 3300027252 Ga0209973_1001808 Ga0209973_10018084 89
910 3300027312 Ga0209371_1000004 Ga0209371_10000041040 89
911 3300027312 Ga0209371_1000294 Ga0209371_100029461 89
912 3300027360 Ga0209969_1000918 Ga0209969_10009182 89
913 3300027364 Ga0209967_1002362 Ga0209967_10023622 89
914 3300027364 Ga0209967_1010565 Ga0209967_10105653 89
915 3300027378 Ga0209981_1005647 Ga0209981_10056472 89
916 3300027424 Ga0209984_1000306 Ga0209984_10003063 89
917 3300027462 Ga0210000_1021598 Ga0210000_10215983 89
918 3300027471 Ga0209995_1000770 Ga0209995_10007704 89
919 3300027526 Ga0209968_1009239 Ga0209968_10092393 89
920 3300027543 Ga0209999_1000336 Ga0209999_10003362 89
921 3300027552 Ga0209982_1000032 Ga0209982_10000329 89
922 3300027614 Ga0209970_1002200 Ga0209970_10022006 89
923 3300027614 Ga0209970_1032210 Ga0209970_10322102 89
924 3300027617 Ga0210002_1002375 Ga0210002_10023754 89
925 3300027665 Ga0209983_1000295 Ga0209983_100029517 89
926 3300027682 Ga0209971_1000410 Ga0209971_100041018 89
927 3300027866 Ga0209813_10405495 Ga0209813_104054952 89
928 3300027876 Ga0209974_10042923 Ga0209974_100429233 89
929 3300027876 Ga0209974_10068042 Ga0209974_100680423 89
930 3300027876 Ga0209974_10119560 Ga0209974_101195602 89
931 3300028379 Ga0268266_10030836 Ga0268266_100308363 89
932 3300028379 Ga0268266_10145338 Ga0268266_101453385 89
933 3300028379 Ga0268266_11543902 Ga0268266_115439021 89
934 3300028380 Ga0268265_10826997 Ga0268265_108269972 89
935 3300028381 Ga0268264_10765519 Ga0268264_107655192 89
936 3300028381 Ga0268264_10849565 Ga0268264_108495653 89
937 3300030500 Ga0268256_1000005 Ga0268256_10000057 89
938 3300030500 Ga0268256_1000258 Ga0268256_10002587 89
939 3300030731 Ga0316177_1205658 Ga0316177_12056582 89
940 3300030732 Ga0316176_1068400 Ga0316176_10684001 89
941 3300030732 Ga0316176_1113603 Ga0316176_11136033 89
942 3300030734 Ga0316179_1001720 Ga0316179_10017202 89
943 3300030734 Ga0316179_1028453 Ga0316179_10284532 89
944 3300030735 Ga0316178_1135743 Ga0316178_11357432 89
945 3300030736 Ga0316180_1091006 Ga0316180_10910062 89
946 3300030742 Ga0316183_1093519 Ga0316183_10935192 89
947 3300030742 Ga0316183_1139965 Ga0316183_11399655 89
948 3300030744 Ga0316181_1032567 Ga0316181_10325672 89
949 3300030745 Ga0316182_1151288 Ga0316182_11512884 89
950 3300030745 Ga0316182_1202883 Ga0316182_12028833 89
951 3300031456 Ga0307513_10155230 Ga0307513_101552303 89
952 3300031548 Ga0307408_100131437 Ga0307408_1001314372 89
953 3300031548 Ga0307408_100186106 Ga0307408_1001861063 89
954 3300031548 Ga0307408_100850933 Ga0307408_1008509332 89
955 3300031548 Ga0307408_100951099 Ga0307408_1009510991 89
956 3300031548 Ga0307408_101741679 Ga0307408_1017416792 89
957 3300031731 Ga0307405_10219242 Ga0307405_102192423 89
958 3300031731 Ga0307405_10996744 Ga0307405_109967441 89
959 3300031731 Ga0307405_11163677 Ga0307405_111636772 89
960 3300031731 Ga0307405_11390891 Ga0307405_113908912 89
961 3300031731 Ga0307405_11684182 Ga0307405_116841822 89
962 3300031824 Ga0307413_10045052 Ga0307413_100450523 89
963 3300031824 Ga0307413_10066958 Ga0307413_100669582 89
964 3300031824 Ga0307413_10165604 Ga0307413_101656044 89
965 3300031824 Ga0307413_10185992 Ga0307413_101859923 89
966 3300031824 Ga0307413_10309588 Ga0307413_103095882 89
967 3300031824 Ga0307413_10500660 Ga0307413_105006602 89
968 3300031824 Ga0307413_10732616 Ga0307413_107326162 89
969 3300031824 Ga0307413_10909208 Ga0307413_109092082 89
970 3300031852 Ga0307410_10028499 Ga0307410_100284995 89
971 3300031852 Ga0307410_10072063 Ga0307410_100720634 89
972 3300031852 Ga0307410_10295603 Ga0307410_102956032 89
973 3300031852 Ga0307410_10987284 Ga0307410_109872842 89
974 3300031901 Ga0307406_10020696 Ga0307406_100206969 89
975 3300031901 Ga0307406_10032367 Ga0307406_100323672 89
976 3300031901 Ga0307406_10167259 Ga0307406_101672592 89
977 3300031901 Ga0307406_11221169 Ga0307406_112211692 89
978 3300031903 Ga0307407_10080990 Ga0307407_100809903 89
979 3300031903 Ga0307407_10416190 Ga0307407_104161901 89
980 3300031911 Ga0307412_10042944 Ga0307412_100429442 89
981 3300031911 Ga0307412_10362043 Ga0307412_103620432 89
982 3300031911 Ga0307412_10436612 Ga0307412_104366123 89
983 3300031911 Ga0307412_10584276 Ga0307412_105842762 89
984 3300031911 Ga0307412_10989806 Ga0307412_109898062 89
985 3300031911 Ga0307412_12322178 Ga0307412_123221782 89
986 3300031995 Ga0307409_100024348 Ga0307409_1000243483 89
987 3300031995 Ga0307409_100908660 Ga0307409_1009086602 89
988 3300031995 Ga0307409_101509557 Ga0307409_1015095572 89
989 3300031995 Ga0307409_102904690 Ga0307409_1029046901 89
990 3300032002 Ga0307416_100470464 Ga0307416_1004704642 89
991 3300032002 Ga0307416_100983219 Ga0307416_1009832192 89
992 3300032002 Ga0307416_101166688 Ga0307416_1011666882 89
993 3300032002 Ga0307416_103855951 Ga0307416_1038559511 89
994 3300032004 Ga0307414_10002120 Ga0307414_1000212017 89
995 3300032004 Ga0307414_10020644 Ga0307414_100206443 89
996 3300032004 Ga0307414_10027193 Ga0307414_100271939 89
997 3300032004 Ga0307414_10028333 Ga0307414_100283339 89
998 3300032004 Ga0307414_10086361 Ga0307414_100863613 89
999 3300032004 Ga0307414_10146524 Ga0307414_101465243 89
1000 3300032004 Ga0307414_10326236 Ga0307414_103262363 89
1001 3300032004 Ga0307414_10560499 Ga0307414_105604992 89
1002 3300032004 Ga0307414_10592129 Ga0307414_105921292 89
1003 3300032004 Ga0307414_11041374 Ga0307414_110413742 89
1004 3300032004 Ga0307414_11052334 Ga0307414_110523342 89
1005 3300032004 Ga0307414_11285973 Ga0307414_112859732 89
1006 3300032005 Ga0307411_10015295 Ga0307411_100152957 89
1007 3300032005 Ga0307411_10041490 Ga0307411_100414903 89
1008 3300032005 Ga0307411_10289441 Ga0307411_102894412 89
1009 3300032005 Ga0307411_10841422 Ga0307411_108414222 89
1010 3300032005 Ga0307411_11179440 Ga0307411_111794402 89
1011 3300032126 Ga0307415_100095911 Ga0307415_1000959112 89
1012 3300032126 Ga0307415_100151338 Ga0307415_1001513382 89
1013 3300032126 Ga0307415_101209228 Ga0307415_1012092282 89
1014 3300033527 Ga0316586_1047246 Ga0316586_10472462 89
1015 3300033541 Ga0316596_1070662 Ga0316596_10706622 89
1016 3300034816 Ga0373930_0022042 Ga0373930_0022042_114_383 89
1017 3300034818 Ga0373950_0057916 Ga0373950_0057916_403_678 89
1018 3300035090 Ga0373949_0263731 Ga0373949_0263731_104_379 89
1019 3300035121 Ga0373960_0313808 Ga0373960_0313808_55_330 89
1020 3300035171 Ga0373946_0301519 Ga0373946_0301519_77_361 89
1021 3300035241 Ga0373961_0154758 Ga0373961_0154758_143_418 89
1022 3300035241 Ga0373961_0366988 Ga0373961_0366988_98_382 89
1023 3300035242 Ga0373962_0045106 Ga0373962_0045106_375_650 89
1024 3300035691 Ga0373931_0476336 Ga0373931_0476336_233_508 89
1025 3300037312 Ga0395899_0093693 Ga0395899_0093693_755_1024 89
1026 3300037312 Ga0395899_0110574 Ga0395899_0110574_901_1170 89
1027 3300037418 Ga0395900_0036642 Ga0395900_0036642_2704_2973 89
1028 3300037466 Ga0395898_0199925 Ga0395898_0199925_994_1263 89
1029 3300037471 Ga0395905_0373903 Ga0395905_0373903_958_1227 89
1030 3300037471 Ga0395905_0474148 Ga0395905_0474148_543_812 89
1031 3300037471 Ga0395905_0575649 Ga0395905_0575649_665_934 89
1032 3300037471 Ga0395905_1025237 Ga0395905_1025237_373_642 89
1033 3300038443 Ga0395901_0276971 Ga0395901_0276971_1411_1680 89
1034 3300038443 Ga0395901_0386130 Ga0395901_0386130_809_1078 89
1035 3300038705 Ga0237819_00026 Ga0237819_00026_46741_47010 89
1036 3300038705 Ga0237819_04573 Ga0237819_04573_482_751 89
1037 3300038726 Ga0400490_04947 Ga0400490_04947_2055_2324 89
1038 3300039145 Ga0237816_00020 Ga0237816_00020_6032_6307 89
1039 3300041404 Ga0439436_0009292 Ga0439436_0009292_1573_1842 89
1040 3300041404 Ga0439436_0026400 Ga0439436_0026400_151_426 89
1041 3300041404 Ga0439436_0059936 Ga0439436_0059936_742_1011 89
1042 3300041404 Ga0439436_0089255 Ga0439436_0089255_396_665 89
1043 3300041404 Ga0439436_0154070 Ga0439436_0154070_25_297 89
1044 3300041406 Ga0439439_0114724 Ga0439439_0114724_183_452 89
1045 3300041408 Ga0439453_0041429 Ga0439453_0041429_161_430 89
1046 3300041410 Ga0439461_0169640 Ga0439461_0169640_165_434 89
1047 3300041411 Ga0439466_0221034 Ga0439466_0221034_101_379 89
1048 3300041413 Ga0439465_0005524 Ga0439465_0005524_1211_1489 89
1049 3300041413 Ga0439465_0009954 Ga0439465_0009954_1477_1752 89
1050 3300041413 Ga0439465_0085583 Ga0439465_0085583_769_1044 89
1051 3300041413 Ga0439465_0435531 Ga0439465_0435531_206_475 89
1052 3300041441 Ga0451787_090900 Ga0451787_090900_607_885 89
1053 3300041442 Ga0451788_12893 Ga0451788_12893_152_430 89
1054 3300041443 Ga0451789_0621874 Ga0451789_0621874_446_724 89
1055 3300041443 Ga0451789_0635352 Ga0451789_0635352_965_1234 89
1056 3300041444 Ga0451790_27784 Ga0451790_27784_400_678 89
1057 3300041446 Ga0451794_25160 Ga0451794_25160_617_895 89
1058 3300041446 Ga0451794_26325 Ga0451794_26325_52_321 89
1059 3300041451 Ga0451791_0166944 Ga0451791_0166944_825_1103 89
1060 3300041451 Ga0451791_1075929 Ga0451791_1075929_95_373 89
1061 3300041452 Ga0451793_1182750 Ga0451793_1182750_433_711 89
1062 3300041452 Ga0451793_1591094 Ga0451793_1591094_3332_3601 89
1063 3300041452 Ga0451793_1717091 Ga0451793_1717091_172_450 89
1064 3300041453 Ga0451797_0821370 Ga0451797_0821370_626_895 89
1065 3300041453 Ga0451797_1216789 Ga0451797_1216789_454_723 89
1066 3300041455 Ga0451801_38637 Ga0451801_38637_85_354 89
1067 3300041456 Ga0451795_0578639 Ga0451795_0578639_604_882 89
1068 3300041457 Ga0451803_13016 Ga0451803_13016_260_538 89
1069 3300041457 Ga0451803_13289 Ga0451803_13289_219_488 89
1070 3300041458 Ga0451798_0397162 Ga0451798_0397162_317_595 89
1071 3300041459 Ga0451800_0592375 Ga0451800_0592375_187_465 89
1072 3300041459 Ga0451800_1057945 Ga0451800_1057945_3324_3593 89
1073 3300041460 Ga0451802_0263205 Ga0451802_0263205_91_369 89
1074 3300041460 Ga0451802_0439083 Ga0451802_0439083_388_666 89
1075 3300041462 Ga0451806_234332 Ga0451806_234332_16153_16422 89
1076 3300041463 Ga0451804_0524950 Ga0451804_0524950_1972_2250 89
1077 3300041464 Ga0451808_08268 Ga0451808_08268_191_469 89
1078 3300041486 Ga0451807_1035554 Ga0451807_1035554_3088_3357 89
1079 3300041486 Ga0451807_1060494 Ga0451807_1060494_25_303 89
1080 3300041486 Ga0451807_1465899 Ga0451807_1465899_139_417 89
1081 3300041491 Ga0451833_0905101 Ga0451833_0905101_383_661 89
1082 3300041492 Ga0451835_0969709 Ga0451835_0969709_131_409 89
1083 3300041494 Ga0451837_1382188 Ga0451837_1382188_782_1051 89
1084 3300041494 Ga0451837_1590620 Ga0451837_1590620_854_1132 89
1085 3300041494 Ga0451837_1810154 Ga0451837_1810154_145_417 89
1086 3300041496 Ga0451839_0840225 Ga0451839_0840225_618_887 89
1087 3300041496 Ga0451839_0845113 Ga0451839_0845113_215_493 89
1088 3300041498 Ga0451841_0213104 Ga0451841_0213104_195_473 89
1089 3300041498 Ga0451841_0393778 Ga0451841_0393778_387_659 89
1090 3300041501 Ga0451845_0463465 Ga0451845_0463465_216_488 89
1091 3300041501 Ga0451845_0895488 Ga0451845_0895488_40_318 89
1092 3300041503 Ga0451847_0253243 Ga0451847_0253243_173_451 89
1093 3300041505 Ga0451849_0324159 Ga0451849_0324159_266_538 89
1094 3300041509 Ga0451843_0252808 Ga0451843_0252808_267_536 89
1095 3300041509 Ga0451843_0577312 Ga0451843_0577312_631_909 89
1096 3300041509 Ga0451843_1183522 Ga0451843_1183522_76_354 89
1097 3300041509 Ga0451843_1351875 Ga0451843_1351875_229_501 89
1098 3300041509 Ga0451843_1466142 Ga0451843_1466142_476_754 89
1099 3300041511 Ga0451855_0479571 Ga0451855_0479571_146_424 89
1100 3300041512 Ga0451853_1908989 Ga0451853_1908989_40_309 89
1101 3300041512 Ga0451853_2139127 Ga0451853_2139127_272_544 89
1102 3300041512 Ga0451853_2432839 Ga0451853_2432839_403_681 89
1103 3300041512 Ga0451853_2729407 Ga0451853_2729407_321_599 89
1104 3300041512 Ga0451853_3391543 Ga0451853_3391543_54_323 89
1105 3300041512 Ga0451853_3672688 Ga0451853_3672688_100_369 89
1106 3300041916 Ga0452271_89492 Ga0452271_89492_161_430 89
1107 3300041997 Ga0439431_0011173 Ga0439431_0011173_1655_1933 89
1108 3300041999 Ga0439433_0032158 Ga0439433_0032158_806_1084 89
1109 3300042005 Ga0439448_0280234 Ga0439448_0280234_107_376 89
1110 3300042006 Ga0439432_077695 Ga0439432_077695_491_760 89
1111 3300042006 Ga0439432_164031 Ga0439432_164031_296_565 89
1112 3300042007 Ga0439449_0011395 Ga0439449_0011395_99_377 89
1113 3300042007 Ga0439449_0018870 Ga0439449_0018870_141_416 89
1114 3300042007 Ga0439449_0025348 Ga0439449_0025348_655_924 89
1115 3300042007 Ga0439449_0047245 Ga0439449_0047245_1210_1479 89
1116 3300042012 Ga0439455_0063857 Ga0439455_0063857_598_867 89
1117 3300042014 Ga0439457_032229 Ga0439457_032229_856_1125 89
1118 3300042134 Ga0450898_034937 Ga0450898_034937_480_749 89
1119 3300042435 Ga0439434_0009664 Ga0439434_0009664_821_1090 89
1120 3300042876 Ga0451577_1946079 Ga0451577_1946079_59_331 89
1121 3300046460 Ga0495638_0236297 Ga0495638_0236297_18_296 89
1122 3300046501 Ga0495607_0050504 Ga0495607_0050504_41_316 89
1123 3300046507 Ga0495606_0067053 Ga0495606_0067053_57_332 89
1124 3300046525 Ga0495663_0004473 Ga0495663_0004473_2517_2795 89
1125 3300046525 Ga0495663_0072031 Ga0495663_0072031_230_499 89
1126 3300046525 Ga0495663_0152058 Ga0495663_0152058_278_547 89
1127 3300046539 Ga0495621_0001470 Ga0495621_0001470_2651_2920 89
1128 3300046539 Ga0495621_0058222 Ga0495621_0058222_494_763 89
1129 3300046539 Ga0495621_0317534 Ga0495621_0317534_251_520 89
1130 3300046615 Ga0495656_0004814 Ga0495656_0004814_1522_1791 89
1131 3300046615 Ga0495656_0006174 Ga0495656_0006174_2108_2377 89
1132 3300046660 Ga0495625_0828324 Ga0495625_0828324_175_453 89
1133 3300046664 Ga0495659_0005979 Ga0495659_0005979_701_970 89
1134 3300046683 Ga0495658_0446652 Ga0495658_0446652_443_718 89
1135 3300046691 Ga0495670_0022396 Ga0495670_0022396_216_485 89
1136 3300047318 Ga0495636_0006169 Ga0495636_0006169_2861_3130 89
1137 3300047318 Ga0495636_0013988 Ga0495636_0013988_552_821 89
1138 3300047318 Ga0495636_0043510 Ga0495636_0043510_703_972 89
1139 3300047320 Ga0495672_0018426 Ga0495672_0018426_2378_2650 89
1140 3300047445 Ga0495677_0188672 Ga0495677_0188672_187_456 89
1141 3300047447 Ga0495685_031122 Ga0495685_031122_1417_1686 89
1142 3300047472 Ga0495686_0184526 Ga0495686_0184526_64_333 89
1143 3300048903 Ga0496100_0372798 Ga0496100_0372798_494_763 89
1144 3300048904 Ga0496101_0051842 Ga0496101_0051842_1565_1834 89
1145 3300048905 Ga0496102_0061345 Ga0496102_0061345_691_960 89
1146 3300048906 Ga0496103_0247026 Ga0496103_0247026_407_676 89
1147 3300048909 Ga0496106_0003988 Ga0496106_0003988_3148_3417 89
1148 3300048910 Ga0496107_0011190 Ga0496107_0011190_2861_3130 89
1149 3300048911 Ga0496108_0001932 Ga0496108_0001932_3260_3529 89
1150 3300048911 Ga0496108_0080196 Ga0496108_0080196_2295_2564 89
1151 3300048912 Ga0496109_0020058 Ga0496109_0020058_458_727 89
1152 3300048912 Ga0496109_0062064 Ga0496109_0062064_2530_2799 89
1153 3300048912 Ga0496109_1502972 Ga0496109_1502972_226_495 89
1154 3300048913 Ga0496110_0011371 Ga0496110_0011371_3715_3984 89
1155 3300048914 Ga0496111_0003793 Ga0496111_0003793_3133_3402 89
1156 3300048915 Ga0496112_0025726 Ga0496112_0025726_2090_2359 89
1157 3300048915 Ga0496112_0260527 Ga0496112_0260527_1153_1422 89
1158 3300048916 Ga0496113_0046904 Ga0496113_0046904_1628_1897 89
1159 3300048917 Ga0496114_0025860 Ga0496114_0025860_2072_2341 89
1160 3300048917 Ga0496114_1122096 Ga0496114_1122096_159_434 89
1161 3300048920 Ga0496117_0028524 Ga0496117_0028524_709_978 89
1162 3300048922 Ga0496119_0542842 Ga0496119_0542842_73_342 89
1163 3300048923 Ga0496120_0024106 Ga0496120_0024106_3344_3613 89
1164 3300048923 Ga0496120_0055218 Ga0496120_0055218_192_461 89
1165 3300048924 Ga0496121_0005001 Ga0496121_0005001_13909_14178 89
1166 3300048925 Ga0496122_0080727 Ga0496122_0080727_254_523 89
1167 3300048925 Ga0496122_0289571 Ga0496122_0289571_563_841 89
1168 3300048926 Ga0496123_0031047 Ga0496123_0031047_3353_3622 89
1169 3300048927 Ga0496124_0000018 Ga0496124_0000018_439394_439669 89
1170 3300048927 Ga0496124_0192756 Ga0496124_0192756_625_894 89
1171 3300048927 Ga0496124_0639966 Ga0496124_0639966_352_621 89
1172 3300048928 Ga0496125_0072907 Ga0496125_0072907_248_520 89
1173 3300048929 Ga0496126_0133819 Ga0496126_0133819_1810_2085 89
1174 3300048929 Ga0496126_1297214 Ga0496126_1297214_199_468 89
1175 3300049127 Ga0501306_000225 Ga0501306_000225_3378_3647 89
1176 3300049127 Ga0501306_102303 Ga0501306_102303_233_502 89
1177 3300049128 Ga0501308_000035 Ga0501308_000035_3409_3678 89
1178 3300049128 Ga0501308_002485 Ga0501308_002485_563_832 89
1179 3300049129 Ga0501309_014517 Ga0501309_014517_717_986 89
1180 3300049130 Ga0501310_000508 Ga0501310_000508_2641_2910 89
1181 3300049131 Ga0501341_09254 Ga0501341_09254_317_586 89
1182 3300049160 Ga0501304_000343 Ga0501304_000343_508_777 89
1183 3300049161 Ga0501305_019665 Ga0501305_019665_441_710 89
1184 3300049161 Ga0501305_071479 Ga0501305_071479_298_567 89
1185 3300049162 Ga0501307_000579 Ga0501307_000579_1984_2253 89
1186 3300049162 Ga0501307_081757 Ga0501307_081757_197_466 89
1187 3300049514 Ga0501291_051071 Ga0501291_051071_20_289 89
1188 3300049517 Ga0501294_018587 Ga0501294_018587_332_601 89
1189 3300049521 Ga0501298_041386 Ga0501298_041386_630_899 89
1190 3300049527 Ga0501311_000483 Ga0501311_000483_271_540 89
1191 3300049527 Ga0501311_015989 Ga0501311_015989_474_743 89
1192 3300049527 Ga0501311_021997 Ga0501311_021997_496_765 89
1193 3300049528 Ga0501312_084155 Ga0501312_084155_292_561 89
1194 3300049529 Ga0501313_005644 Ga0501313_005644_549_818 89
1195 3300049530 Ga0501314_000253 Ga0501314_000253_225_494 89
1196 3300049531 Ga0501315_000712 Ga0501315_000712_859_1128 89
1197 3300049532 Ga0501316_005838 Ga0501316_005838_577_846 89
1198 3300049532 Ga0501316_056936 Ga0501316_056936_170_442 89
1199 3300049533 Ga0501317_003255 Ga0501317_003255_1087_1356 89
1200 3300049533 Ga0501317_003443 Ga0501317_003443_1088_1360 89
1201 3300049535 Ga0501319_000070 Ga0501319_000070_1888_2157 89
1202 3300049536 Ga0501320_000093 Ga0501320_000093_968_1237 89
1203 3300049536 Ga0501320_003078 Ga0501320_003078_174_443 89
1204 3300049537 Ga0501321_002115 Ga0501321_002115_918_1187 89
1205 3300049538 Ga0501322_000356 Ga0501322_000356_1380_1649 89
1206 3300049539 Ga0501323_000068 Ga0501323_000068_2776_3045 89
1207 3300049539 Ga0501323_000101 Ga0501323_000101_2547_2816 89
1208 3300049540 Ga0501324_000043 Ga0501324_000043_1392_1661 89
1209 3300049540 Ga0501324_038756 Ga0501324_038756_66_335 89
1210 3300049541 Ga0501325_000419 Ga0501325_000419_231_500 89
1211 3300049544 Ga0501328_08502 Ga0501328_08502_196_465 89
1212 3300049545 Ga0501329_00991 Ga0501329_00991_135_404 89
1213 3300049546 Ga0501330_015863 Ga0501330_015863_117_386 89
1214 3300049546 Ga0501330_024255 Ga0501330_024255_105_374 89
1215 3300049547 Ga0501331_11829 Ga0501331_11829_180_449 89
1216 3300049548 Ga0501332_01483 Ga0501332_01483_98_367 89
1217 3300049549 Ga0501333_020476 Ga0501333_020476_86_355 89
1218 3300049550 Ga0501334_02106 Ga0501334_02106_152_421 89
1219 3300049551 Ga0501335_020727 Ga0501335_020727_227_496 89
1220 3300049552 Ga0501336_000152 Ga0501336_000152_378_647 89
1221 3300049552 Ga0501336_024562 Ga0501336_024562_245_514 89
1222 3300049556 Ga0501340_000766 Ga0501340_000766_1019_1288 89
1223 3300049556 Ga0501340_006087 Ga0501340_006087_159_428 89
1224 3300049568 Ga0501031_0025141 Ga0501031_0025141_1495_1764 89
1225 3300049568 Ga0501031_0199292 Ga0501031_0199292_392_664 89
1226 3300049569 Ga0501032_0199653 Ga0501032_0199653_660_932 89
1227 3300049569 Ga0501032_1039952 Ga0501032_1039952_217_486 89
1228 3300049570 Ga0501033_0082546 Ga0501033_0082546_2069_2338 89
1229 3300049570 Ga0501033_0405492 Ga0501033_0405492_72_344 89
1230 3300049571 Ga0501034_0007020 Ga0501034_0007020_619_891 89
1231 3300049571 Ga0501034_0021966 Ga0501034_0021966_3269_3538 89
1232 3300049571 Ga0501034_0026172 Ga0501034_0026172_2195_2470 89
1233 3300049571 Ga0501034_1022939 Ga0501034_1022939_200_469 89
1234 3300049572 Ga0501036_0066357 Ga0501036_0066357_2535_2807 89
1235 3300049573 Ga0501037_0021232 Ga0501037_0021232_2929_3201 89
1236 3300049574 Ga0501038_0002396 Ga0501038_0002396_3371_3643 89
1237 3300049574 Ga0501038_0026720 Ga0501038_0026720_3158_3427 89
1238 3300049575 Ga0501039_0013271 Ga0501039_0013271_1909_2181 89
1239 3300049579 Ga0501043_0030616 Ga0501043_0030616_727_996 89
1240 3300049579 Ga0501043_0467547 Ga0501043_0467547_560_832 89
1241 3300049581 Ga0501047_0059275 Ga0501047_0059275_1503_1772 89
1242 3300049581 Ga0501047_0290604 Ga0501047_0290604_558_830 89
1243 3300049584 Ga0501068_0264389 Ga0501068_0264389_600_872 89
1244 3300049586 Ga0501070_0016046 Ga0501070_0016046_1572_1844 89
1245 3300049587 Ga0501071_0037161 Ga0501071_0037161_1986_2258 89
1246 3300049589 Ga0501073_0145837 Ga0501073_0145837_1265_1537 89
1247 3300049590 Ga0501074_0601228 Ga0501074_0601228_254_526 89
1248 3300049649 Ga0501198_024968 Ga0501198_024968_71_340 89
1249 3300049651 Ga0501201_010017 Ga0501201_010017_566_835 89
1250 3300049652 Ga0501202_005500 Ga0501202_005500_574_843 89
1251 3300049655 Ga0501208_047426 Ga0501208_047426_211_480 89
1252 3300049658 Ga0501211_040584 Ga0501211_040584_131_400 89
1253 3300049660 Ga0501216_029379 Ga0501216_029379_461_730 89
1254 3300049661 Ga0501217_024102 Ga0501217_024102_512_781 89
1255 3300049663 Ga0501223_049764 Ga0501223_049764_122_391 89
1256 3300049668 Ga0501233_122410 Ga0501233_122410_352_621 89
1257 3300049672 Ga0501239_032668 Ga0501239_032668_248_517 89
1258 3300049673 Ga0501240_021223 Ga0501240_021223_71_340 89
1259 3300049674 Ga0501242_019868 Ga0501242_019868_353_622 89
1260 3300049675 Ga0501243_023627 Ga0501243_023627_523_792 89
1261 3300049676 Ga0501246_003367 Ga0501246_003367_951_1220 89
1262 3300049678 Ga0501248_059146 Ga0501248_059146_127_396 89
1263 3300049679 Ga0501249_015941 Ga0501249_015941_530_799 89
1264 3300049680 Ga0501250_002526 Ga0501250_002526_181_450 89
1265 3300049682 Ga0501252_000295 Ga0501252_000295_2064_2333 89
1266 3300049683 Ga0501253_005515 Ga0501253_005515_817_1086 89
1267 3300049686 Ga0501257_001372 Ga0501257_001372_4452_4721 89
1268 3300049687 Ga0501258_010110 Ga0501258_010110_494_763 89
1269 3300049688 Ga0501259_018185 Ga0501259_018185_704_973 89
1270 3300049690 Ga0501261_028813 Ga0501261_028813_320_589 89
1271 3300049705 Ga0501225_0016391 Ga0501225_0016391_279_548 89
1272 3300049705 Ga0501225_0040103 Ga0501225_0040103_646_921 89
1273 3300049707 Ga0501234_092362 Ga0501234_092362_166_435 89
1274 3300049742 Ga0501080_0018310 Ga0501080_0018310_3522_3794 89
1275 3300049757 Ga0501232_002388 Ga0501232_002388_1215_1484 89
1276 3300049758 Ga0501241_042149 Ga0501241_042149_92_361 89
1277 3300049759 Ga0501262_021896 Ga0501262_021896_97_366 89
1278 3300049761 Ga0501264_025261 Ga0501264_025261_299_568 89
1279 3300049765 Ga0501268_005031 Ga0501268_005031_489_758 89
1280 3300049766 Ga0501269_017938 Ga0501269_017938_520_789 89
1281 3300049767 Ga0501270_002142 Ga0501270_002142_83_352 89
1282 3300049767 Ga0501270_053341 Ga0501270_053341_268_537 89
1283 3300049771 Ga0501274_002795 Ga0501274_002795_870_1139 89
1284 3300049772 Ga0501275_059346 Ga0501275_059346_135_404 89
1285 3300049773 Ga0501276_029898 Ga0501276_029898_110_379 89
1286 3300049778 Ga0501282_008793 Ga0501282_008793_254_523 89
1287 3300049822 Ga0501035_0003746 Ga0501035_0003746_12678_12950 89
1288 3300049822 Ga0501035_1417258 Ga0501035_1417258_134_403 89
1289 3300049823 Ga0501044_0003730 Ga0501044_0003730_1865_2137 89
1290 3300049823 Ga0501044_0128695 Ga0501044_0128695_558_827 89
1291 3300049851 Ga0501212_115757 Ga0501212_115757_121_390 89
1292 3300050491 nmdc:mga00v17_16326_c1 nmdc:mga00v17_16326_c1_1432_1704 89
1293 3300050492 nmdc:mga0yw44_46615_c1 nmdc:mga0yw44_46615_c1_953_1225 89
1294 3300050493 nmdc:mga0k408_310974_c1 nmdc:mga0k408_310974_c1_223_501 89
1295 3300050510 nmdc:mga06r32_193219_c1 nmdc:mga06r32_193219_c1_629_1015 89
1296 3300053079 Ga0500610_0000159 Ga0500610_0000159_2979_3257 89
1297 3300053093 Ga0500651_0003432 Ga0500651_0003432_68_346 89
1298 3300053120 Ga0500597_062838 Ga0500597_062838_763_1035 89
1299 3300053146 Ga0500588_0196933 Ga0500588_0196933_137_415 89
1300 3300053161 Ga0500634_0003199 Ga0500634_0003199_3552_3821 89
1301 3300059421 Ga0590071_207707 Ga0590071_207707_179_448 89
1302 3300059477 Ga0587084_077374 Ga0587084_077374_164_436 89
1303 3300059477 Ga0587084_085017 Ga0587084_085017_148_420 89
1304 3300059491 Ga0587070_028246 Ga0587070_028246_105_377 89
1305 3300059505 Ga0587083_0110553 Ga0587083_0110553_112_381 89
1306 3300059510 Ga0587090_012962 Ga0587090_012962_175_447 89
1307 3300059510 Ga0587090_126137 Ga0587090_126137_129_398 89
1308 3300059623 Ga0587101_032821 Ga0587101_032821_519_797 89
1309 3300060344 Ga0587071_043226 Ga0587071_043226_488_757 89
1310 3300060346 Ga0587111_0013258 Ga0587111_0013258_635_907 89
1311 3300001904 JGI24736J21556_1000834 JGI24736J21556_10008342 90
1312 3300001904 JGI24736J21556_1015964 JGI24736J21556_10159643 90
1313 3300001904 JGI24736J21556_1018996 JGI24736J21556_10189962 90
1314 3300001904 JGI24736J21556_1019775 JGI24736J21556_10197753 90
1315 3300001979 JGI24740J21852_10006264 JGI24740J21852_100062647 90
1316 3300001979 JGI24740J21852_10033981 JGI24740J21852_100339813 90
1317 3300001979 JGI24740J21852_10078599 JGI24740J21852_100785992 90
1318 3300001989 JGI24739J22299_10000118 JGI24739J22299_100001185 90
1319 3300001989 JGI24739J22299_10006773 JGI24739J22299_100067732 90
1320 3300001990 JGI24737J22298_10000685 JGI24737J22298_100006852 90
1321 3300001990 JGI24737J22298_10010174 JGI24737J22298_100101743 90
1322 3300001990 JGI24737J22298_10010685 JGI24737J22298_100106852 90
1323 3300001990 JGI24737J22298_10016732 JGI24737J22298_100167322 90
1324 3300001990 JGI24737J22298_10029906 JGI24737J22298_100299063 90
1325 3300002067 JGI24735J21928_10009574 JGI24735J21928_100095745 90
1326 3300002067 JGI24735J21928_10011190 JGI24735J21928_100111905 90
1327 3300002067 JGI24735J21928_10015249 JGI24735J21928_100152495 90
1328 3300002067 JGI24735J21928_10016331 JGI24735J21928_100163314 90
1329 3300002075 JGI24738J21930_10000244 JGI24738J21930_100002446 90
1330 3300002075 JGI24738J21930_10015057 JGI24738J21930_100150573 90
1331 3300002705 JGI25156J39149_1002085 JGI25156J39149_10020859 90
1332 3300002705 JGI25156J39149_1002290 JGI25156J39149_10022907 90
1333 3300002705 JGI25156J39149_1022805 JGI25156J39149_10228051 90
1334 3300002737 JGI25162J39368_1003847 JGI25162J39368_10038477 90
1335 3300002737 JGI25162J39368_1003864 JGI25162J39368_10038642 90
1336 3300002737 JGI25162J39368_1003895 JGI25162J39368_10038956 90
1337 3300002737 JGI25162J39368_1009073 JGI25162J39368_10090733 90
1338 3300002737 JGI25162J39368_1012641 JGI25162J39368_10126412 90
1339 3300002738 JGI25154J39366_1008638 JGI25154J39366_10086382 90
1340 3300002738 JGI25154J39366_1012839 JGI25154J39366_10128391 90
1341 3300002738 JGI25154J39366_1017829 JGI25154J39366_10178292 90
1342 3300002741 JGI25157J39369_1001153 JGI25157J39369_10011537 90
1343 3300002741 JGI25157J39369_1001750 JGI25157J39369_10017509 90
1344 3300002741 JGI25157J39369_1001921 JGI25157J39369_10019216 90
1345 3300002741 JGI25157J39369_1002043 JGI25157J39369_10020437 90
1346 3300002741 JGI25157J39369_1002044 JGI25157J39369_10020447 90
1347 3300002741 JGI25157J39369_1022941 JGI25157J39369_10229412 90
1348 3300002771 JGI25163J39215_1001413 JGI25163J39215_10014132 90
1349 3300002772 JGI25164J39214_1000312 JGI25164J39214_100031233 90
1350 3300002772 JGI25164J39214_1000781 JGI25164J39214_10007817 90
1351 3300002772 JGI25164J39214_1004872 JGI25164J39214_10048723 90
1352 3300002773 JGI25152J39213_1022406 JGI25152J39213_10224062 90
1353 3300002773 JGI25152J39213_1037569 JGI25152J39213_10375692 90
1354 3300002865 Ga0006761J43178_114168 Ga0006761J43178_1141681 90
1355 3300003214 JGI25165J46597_1000586 JGI25165J46597_100058633 90
1356 3300003214 JGI25165J46597_1001532 JGI25165J46597_100153217 90
1357 3300003214 JGI25165J46597_1009174 JGI25165J46597_10091743 90
1358 3300003305 Ga0006770J48903_1007534 Ga0006770J48903_10075346 90
1359 3300003479 Ga0006556J51387_1018520 Ga0006556J51387_10185206 90
1360 3300003479 Ga0006556J51387_1029536 Ga0006556J51387_10295362 90
1361 3300003558 Ga0006558J51389_1018313 Ga0006558J51389_10183136 90
1362 3300003558 Ga0006558J51389_1029818 Ga0006558J51389_10298182 90
1363 3300003565 Ga0006560J51390_1017170 Ga0006560J51390_10171706 90
1364 3300003565 Ga0006560J51390_1022861 Ga0006560J51390_10228612 90
1365 3300003567 Ga0006554J51385_1017088 Ga0006554J51385_10170886 90
1366 3300003567 Ga0006554J51385_1020490 Ga0006554J51385_10204907 90
1367 3300003575 Ga0007409J51694_1052656 Ga0007409J51694_10526562 90
1368 3300003578 Ga0006562J51391_1006869 Ga0006562J51391_100686919 90
1369 3300003578 Ga0006562J51391_1018587 Ga0006562J51391_10185876 90
1370 3300003579 Ga0007429J51699_1058662 Ga0007429J51699_10586622 90
1371 3300003693 Ga0032354_1059945 Ga0032354_10599451 90
1372 3300003751 Ga0055538_1000680 Ga0055538_100068018 90
1373 3300003752 Ga0055539_1000456 Ga0055539_10004567 90
1374 3300003756 Ga0055533_1000432 Ga0055533_100043223 90
1375 3300003756 Ga0055533_1002319 Ga0055533_10023196 90
1376 3300003756 Ga0055533_1006853 Ga0055533_10068533 90
1377 3300003759 Ga0055525_1000111 Ga0055525_100011134 90
1378 3300003760 Ga0055527_1001178 Ga0055527_10011786 90
1379 3300003760 Ga0055527_1001334 Ga0055527_10013346 90
1380 3300003760 Ga0055527_1012562 Ga0055527_10125622 90
1381 3300003761 Ga0055535_1002650 Ga0055535_10026507 90
1382 3300003761 Ga0055535_1002929 Ga0055535_10029295 90
1383 3300003761 Ga0055535_1004862 Ga0055535_10048622 90
1384 3300003761 Ga0055535_1006090 Ga0055535_10060902 90
1385 3300003761 Ga0055535_1006166 Ga0055535_10061664 90
1386 3300003762 Ga0055542_1002512 Ga0055542_10025126 90
1387 3300003762 Ga0055542_1003780 Ga0055542_10037807 90
1388 3300003762 Ga0055542_1003848 Ga0055542_10038482 90
1389 3300003762 Ga0055542_1003932 Ga0055542_10039325 90
1390 3300003762 Ga0055542_1004903 Ga0055542_10049035 90
1391 3300003762 Ga0055542_1006542 Ga0055542_10065424 90
1392 3300003763 Ga0055529_1001670 Ga0055529_10016707 90
1393 3300003763 Ga0055529_1002611 Ga0055529_10026116 90
1394 3300003763 Ga0055529_1010809 Ga0055529_10108092 90
1395 3300003763 Ga0055529_1024724 Ga0055529_10247242 90
1396 3300003792 Ga0055540_1080191 Ga0055540_10801911 90
1397 3300004800 Ga0058861_11948199 Ga0058861_119481993 90
1398 3300004801 Ga0058860_10137024 Ga0058860_101370242 90
1399 3300005262 Ga0065165_1000598 Ga0065165_100059856 90
1400 3300005262 Ga0065165_1018680 Ga0065165_10186804 90
1401 3300005288 Ga0065714_10358246 Ga0065714_103582462 90
1402 3300005327 Ga0070658_10080946 Ga0070658_100809463 90
1403 3300005327 Ga0070658_11431930 Ga0070658_114319302 90
1404 3300005327 Ga0070658_11519369 Ga0070658_115193692 90
1405 3300005329 Ga0070683_101560370 Ga0070683_1015603702 90
1406 3300005335 Ga0070666_10000012 Ga0070666_100000127 90
1407 3300005336 Ga0070680_100226132 Ga0070680_1002261322 90
1408 3300005336 Ga0070680_100631886 Ga0070680_1006318862 90
1409 3300005336 Ga0070680_100884344 Ga0070680_1008843441 90
1410 3300005337 Ga0070682_100050614 Ga0070682_1000506144 90
1411 3300005337 Ga0070682_100148284 Ga0070682_1001482841 90
1412 3300005339 Ga0070660_101781207 Ga0070660_1017812071 90
1413 3300005340 Ga0070689_100013126 Ga0070689_1000131262 90
1414 3300005341 Ga0070691_10220115 Ga0070691_102201153 90
1415 3300005344 Ga0070661_100015281 Ga0070661_1000152815 90
1416 3300005344 Ga0070661_100025376 Ga0070661_1000253763 90
1417 3300005344 Ga0070661_100025415 Ga0070661_1000254159 90
1418 3300005344 Ga0070661_100028282 Ga0070661_1000282826 90
1419 3300005345 Ga0070692_10043999 Ga0070692_100439993 90
1420 3300005347 Ga0070668_100342193 Ga0070668_1003421932 90
1421 3300005365 Ga0070688_100158691 Ga0070688_1001586911 90
1422 3300005366 Ga0070659_100342152 Ga0070659_1003421521 90
1423 3300005366 Ga0070659_100889984 Ga0070659_1008899842 90
1424 3300005367 Ga0070667_100062633 Ga0070667_1000626334 90
1425 3300005367 Ga0070667_102165261 Ga0070667_1021652612 90
1426 3300005435 Ga0070714_100086583 Ga0070714_1000865832 90
1427 3300005435 Ga0070714_101165314 Ga0070714_1011653142 90
1428 3300005436 Ga0070713_100008401 Ga0070713_1000084017 90
1429 3300005439 Ga0070711_100176889 Ga0070711_1001768893 90
1430 3300005455 Ga0070663_100024491 Ga0070663_1000244913 90
1431 3300005455 Ga0070663_100036003 Ga0070663_1000360031 90
1432 3300005455 Ga0070663_100053898 Ga0070663_1000538982 90
1433 3300005455 Ga0070663_100059429 Ga0070663_1000594294 90
1434 3300005456 Ga0070678_100112773 Ga0070678_1001127733 90
1435 3300005457 Ga0070662_100378057 Ga0070662_1003780571 90
1436 3300005458 Ga0070681_10075723 Ga0070681_100757233 90
1437 3300005458 Ga0070681_10245444 Ga0070681_102454442 90
1438 3300005458 Ga0070681_10319454 Ga0070681_103194541 90
1439 3300005458 Ga0070681_11141223 Ga0070681_111412232 90
1440 3300005466 Ga0070685_10002255 Ga0070685_100022555 90
1441 3300005518 Ga0070699_101195153 Ga0070699_1011951531 90
1442 3300005530 Ga0070679_100078448 Ga0070679_1000784484 90
1443 3300005530 Ga0070679_100149442 Ga0070679_1001494422 90
1444 3300005530 Ga0070679_100235593 Ga0070679_1002355932 90
1445 3300005530 Ga0070679_100657230 Ga0070679_1006572302 90
1446 3300005530 Ga0070679_101254332 Ga0070679_1012543322 90
1447 3300005535 Ga0070684_102348363 Ga0070684_1023483631 90
1448 3300005546 Ga0070696_100008697 Ga0070696_1000086972 90
1449 3300005546 Ga0070696_100010164 Ga0070696_10001016410 90
1450 3300005546 Ga0070696_100243762 Ga0070696_1002437622 90
1451 3300005547 Ga0070693_100025657 Ga0070693_1000256573 90
1452 3300005547 Ga0070693_100028679 Ga0070693_1000286793 90
1453 3300005547 Ga0070693_100627916 Ga0070693_1006279162 90
1454 3300005548 Ga0070665_100004322 Ga0070665_10000432224 90
1455 3300005563 Ga0068855_100384533 Ga0068855_1003845332 90
1456 3300005577 Ga0068857_100000998 Ga0068857_10000099830 90
1457 3300005577 Ga0068857_100803211 Ga0068857_1008032112 90
1458 3300005578 Ga0068854_100054495 Ga0068854_1000544955 90
1459 3300005578 Ga0068854_100371921 Ga0068854_1003719212 90
1460 3300005614 Ga0068856_100004797 Ga0068856_1000047977 90
1461 3300005614 Ga0068856_100076451 Ga0068856_1000764512 90
1462 3300005614 Ga0068856_101178948 Ga0068856_1011789482 90
1463 3300005616 Ga0068852_100058397 Ga0068852_1000583975 90
1464 3300005617 Ga0068859_100448251 Ga0068859_1004482511 90
1465 3300005834 Ga0068851_10069055 Ga0068851_100690552 90
1466 3300005842 Ga0068858_100048710 Ga0068858_1000487103 90
1467 3300005843 Ga0068860_100054090 Ga0068860_1000540905 90
1468 3300005844 Ga0068862_100010918 Ga0068862_10001091817 90
1469 3300006175 Ga0070712_100613481 Ga0070712_1006134812 90
1470 3300006186 Ga0075369_10290472 Ga0075369_102904721 90
1471 3300006186 Ga0075369_10382298 Ga0075369_103822982 90
1472 3300006931 Ga0097620_100448238 Ga0097620_1004482383 90
1473 3300009036 Ga0105244_10053267 Ga0105244_100532672 90
1474 3300009093 Ga0105240_10197401 Ga0105240_101974014 90
1475 3300009093 Ga0105240_10501699 Ga0105240_105016992 90
1476 3300009093 Ga0105240_11935306 Ga0105240_119353061 90
1477 3300009101 Ga0105247_10001324 Ga0105247_100013247 90
1478 3300009174 Ga0105241_10747461 Ga0105241_107474612 90
1479 3300009174 Ga0105241_11454355 Ga0105241_114543551 90
1480 3300009177 Ga0105248_10477317 Ga0105248_104773172 90
1481 3300009545 Ga0105237_10050085 Ga0105237_100500857 90
1482 3300009545 Ga0105237_10051347 Ga0105237_100513477 90
1483 3300009545 Ga0105237_10073900 Ga0105237_100739001 90
1484 3300009551 Ga0105238_10039356 Ga0105238_100393567 90
1485 3300009551 Ga0105238_10194845 Ga0105238_101948452 90
1486 3300009551 Ga0105238_10229232 Ga0105238_102292322 90
1487 3300009551 Ga0105238_11990834 Ga0105238_119908342 90
1488 3300009553 Ga0105249_10660003 Ga0105249_106600033 90
1489 3300010375 Ga0105239_10006660 Ga0105239_100066607 90
1490 3300010375 Ga0105239_10198957 Ga0105239_101989574 90
1491 3300010375 Ga0105239_10797249 Ga0105239_107972492 90
1492 3300011119 Ga0105246_11823845 Ga0105246_118238452 90
1493 3300012477 Ga0157336_1033126 Ga0157336_10331262 90
1494 3300013100 Ga0157373_10630228 Ga0157373_106302282 90
1495 3300013102 Ga0157371_10357405 Ga0157371_103574052 90
1496 3300013102 Ga0157371_10648800 Ga0157371_106488003 90
1497 3300013104 Ga0157370_10062752 Ga0157370_100627523 90
1498 3300013104 Ga0157370_10333870 Ga0157370_103338702 90
1499 3300013104 Ga0157370_11421509 Ga0157370_114215091 90
1500 3300013104 Ga0157370_11890703 Ga0157370_118907031 90
1501 3300013105 Ga0157369_10004613 Ga0157369_100046136 90
1502 3300013105 Ga0157369_10036937 Ga0157369_100369377 90
1503 3300013105 Ga0157369_10053594 Ga0157369_1005359410 90
1504 3300013105 Ga0157369_10097097 Ga0157369_100970973 90
1505 3300013105 Ga0157369_10422405 Ga0157369_104224052 90
1506 3300013105 Ga0157369_12570683 Ga0157369_125706831 90
1507 3300013105 Ga0157369_12643170 Ga0157369_126431702 90
1508 3300013306 Ga0163162_10001854 Ga0163162_100018547 90
1509 3300013306 Ga0163162_10283689 Ga0163162_102836893 90
1510 3300013307 Ga0157372_13309861 Ga0157372_133098612 90
1511 3300013308 Ga0157375_10347661 Ga0157375_103476613 90
1512 3300014325 Ga0163163_10886479 Ga0163163_108864793 90
1513 3300014497 Ga0182008_10003539 Ga0182008_1000353919 90
1514 3300014497 Ga0182008_10003930 Ga0182008_100039302 90
1515 3300014968 Ga0157379_10687348 Ga0157379_106873483 90
1516 3300014969 Ga0157376_10009877 Ga0157376_100098774 90
1517 3300015261 Ga0182006_1002396 Ga0182006_10023962 90
1518 3300015261 Ga0182006_1010232 Ga0182006_10102322 90
1519 3300015261 Ga0182006_1082397 Ga0182006_10823973 90
1520 3300015261 Ga0182006_1120228 Ga0182006_11202282 90
1521 3300015262 Ga0182007_10001054 Ga0182007_1000105421 90
1522 3300015262 Ga0182007_10441466 Ga0182007_104414662 90
1523 3300015265 Ga0182005_1014484 Ga0182005_10144842 90
1524 3300015685 Ga0183369_1007 Ga0183369_1007156 90
1525 3300015687 Ga0183368_1002 Ga0183368_1002392 90
1526 3300019177 Ga0184592_105364 Ga0184592_1053644 90
1527 3300020069 Ga0197907_10134550 Ga0197907_101345502 90
1528 3300020070 Ga0206356_11514200 Ga0206356_115142003 90
1529 3300020076 Ga0206355_1097630 Ga0206355_10976302 90
1530 3300020076 Ga0206355_1206608 Ga0206355_12066082 90
1531 3300020076 Ga0206355_1347985 Ga0206355_13479857 90
1532 3300020076 Ga0206355_1568832 Ga0206355_15688321 90
1533 3300020077 Ga0206351_10721784 Ga0206351_107217842 90
1534 3300020078 Ga0206352_11190509 Ga0206352_111905092 90
1535 3300020078 Ga0206352_11332379 Ga0206352_113323792 90
1536 3300020080 Ga0206350_10079206 Ga0206350_100792065 90
1537 3300020080 Ga0206350_11418185 Ga0206350_114181852 90
1538 3300020081 Ga0206354_11635997 Ga0206354_116359972 90
1539 3300020082 Ga0206353_10078560 Ga0206353_100785602 90
1540 3300020082 Ga0206353_11707293 Ga0206353_117072932 90
1541 3300020610 Ga0154015_1554875 Ga0154015_15548752 90
1542 3300022467 Ga0224712_10003939 Ga0224712_100039393 90
1543 3300022467 Ga0224712_10093803 Ga0224712_100938032 90
1544 3300025206 Ga0209435_105832 Ga0209435_1058321 90
1545 3300025206 Ga0209435_128097 Ga0209435_1280971 90
1546 3300025207 Ga0209760_101310 Ga0209760_1013104 90
1547 3300025224 Ga0209784_100167 Ga0209784_10016758 90
1548 3300025225 Ga0209566_102636 Ga0209566_1026362 90
1549 3300025226 Ga0209674_100043 Ga0209674_100043360 90
1550 3300025226 Ga0209674_100381 Ga0209674_10038130 90
1551 3300025226 Ga0209674_102055 Ga0209674_1020556 90
1552 3300025228 Ga0209672_100004 Ga0209672_1000041299 90
1553 3300025228 Ga0209672_100029 Ga0209672_1000297 90
1554 3300025228 Ga0209672_101110 Ga0209672_10111017 90
1555 3300025228 Ga0209672_102109 Ga0209672_1021093 90
1556 3300025228 Ga0209672_104042 Ga0209672_1040422 90
1557 3300025230 Ga0209563_100103 Ga0209563_10010334 90
1558 3300025231 Ga0207427_100144 Ga0207427_1001447 90
1559 3300025231 Ga0207427_100209 Ga0207427_1002097 90
1560 3300025231 Ga0207427_100327 Ga0207427_1003277 90
1561 3300025233 Ga0209437_100020 Ga0209437_100020619 90
1562 3300025233 Ga0209437_100193 Ga0209437_100193104 90
1563 3300025233 Ga0209437_100256 Ga0209437_10025682 90
1564 3300025233 Ga0209437_100465 Ga0209437_10046533 90
1565 3300025233 Ga0209437_122720 Ga0209437_1227202 90
1566 3300025242 Ga0209258_100003 Ga0209258_1000031299 90
1567 3300025242 Ga0209258_100053 Ga0209258_100053323 90
1568 3300025242 Ga0209258_100149 Ga0209258_100149155 90
1569 3300025242 Ga0209258_100329 Ga0209258_1003297 90
1570 3300025242 Ga0209258_103384 Ga0209258_1033846 90
1571 3300025246 Ga0209646_1000796 Ga0209646_100079612 90
1572 3300025246 Ga0209646_1002116 Ga0209646_10021168 90
1573 3300025246 Ga0209646_1002559 Ga0209646_10025592 90
1574 3300025250 Ga0209026_1000060 Ga0209026_10000607 90
1575 3300025250 Ga0209026_1000274 Ga0209026_100027446 90
1576 3300025250 Ga0209026_1000293 Ga0209026_100029358 90
1577 3300025250 Ga0209026_1000516 Ga0209026_10005167 90
1578 3300025250 Ga0209026_1001271 Ga0209026_10012717 90
1579 3300025250 Ga0209026_1020399 Ga0209026_10203992 90
1580 3300025253 Ga0209677_101383 Ga0209677_10138320 90
1581 3300025254 Ga0209148_1000002 Ga0209148_10000021285 90
1582 3300025254 Ga0209148_1000009 Ga0209148_10000097 90
1583 3300025254 Ga0209148_1000010 Ga0209148_10000101162 90
1584 3300025254 Ga0209148_1000025 Ga0209148_1000025603 90
1585 3300025254 Ga0209148_1000039 Ga0209148_10000396 90
1586 3300025254 Ga0209148_1000143 Ga0209148_1000143155 90
1587 3300025254 Ga0209148_1002653 Ga0209148_10026533 90
1588 3300025256 Ga0209759_1000658 Ga0209759_100065833 90
1589 3300025256 Ga0209759_1001361 Ga0209759_10013612 90
1590 3300025256 Ga0209759_1001919 Ga0209759_10019197 90
1591 3300025256 Ga0209759_1002020 Ga0209759_10020207 90
1592 3300025256 Ga0209759_1007439 Ga0209759_10074393 90
1593 3300025258 Ga0209129_1000835 Ga0209129_100083510 90
1594 3300025258 Ga0209129_1002898 Ga0209129_10028986 90
1595 3300025261 Ga0209233_1000009 Ga0209233_10000097 90
1596 3300025261 Ga0209233_1000020 Ga0209233_10000207 90
1597 3300025261 Ga0209233_1000151 Ga0209233_1000151165 90
1598 3300025261 Ga0209233_1000920 Ga0209233_100092021 90
1599 3300025261 Ga0209233_1012013 Ga0209233_10120135 90
1600 3300025272 Ga0209455_1000004 Ga0209455_10000041299 90
1601 3300025272 Ga0209455_1000034 Ga0209455_10000347 90
1602 3300025272 Ga0209455_1000060 Ga0209455_10000607 90
1603 3300025272 Ga0209455_1000086 Ga0209455_10000867 90
1604 3300025272 Ga0209455_1000095 Ga0209455_100009573 90
1605 3300025272 Ga0209455_1011194 Ga0209455_10111944 90
1606 3300025272 Ga0209455_1043089 Ga0209455_10430892 90
1607 3300025294 Ga0209025_1066487 Ga0209025_10664872 90
1608 3300025297 Ga0209758_1005974 Ga0209758_100597413 90
1609 3300025297 Ga0209758_1015882 Ga0209758_10158824 90
1610 3300025297 Ga0209758_1073799 Ga0209758_10737993 90
1611 3300025299 Ga0209256_1002932 Ga0209256_10029328 90
1612 3300025302 Ga0207426_1003657 Ga0207426_10036578 90
1613 3300025302 Ga0207426_1051574 Ga0207426_10515743 90
1614 3300025303 Ga0209051_1009647 Ga0209051_100964711 90
1615 3300025304 Ga0209257_1025983 Ga0209257_10259834 90
1616 3300025321 Ga0207656_10068377 Ga0207656_100683773 90
1617 3300025321 Ga0207656_10404474 Ga0207656_104044742 90
1618 3300025900 Ga0207710_10012197 Ga0207710_100121979 90
1619 3300025901 Ga0207688_10209947 Ga0207688_102099473 90
1620 3300025903 Ga0207680_10000013 Ga0207680_100000137 90
1621 3300025904 Ga0207647_10000287 Ga0207647_100002872 90
1622 3300025904 Ga0207647_10011795 Ga0207647_100117958 90
1623 3300025904 Ga0207647_10032989 Ga0207647_100329895 90
1624 3300025904 Ga0207647_10320677 Ga0207647_103206771 90
1625 3300025909 Ga0207705_10021621 Ga0207705_1002162110 90
1626 3300025909 Ga0207705_10073017 Ga0207705_100730174 90
1627 3300025909 Ga0207705_10512598 Ga0207705_105125982 90
1628 3300025911 Ga0207654_10184058 Ga0207654_101840582 90
1629 3300025911 Ga0207654_10478139 Ga0207654_104781393 90
1630 3300025912 Ga0207707_10006555 Ga0207707_1000655521 90
1631 3300025912 Ga0207707_10007311 Ga0207707_1000731113 90
1632 3300025912 Ga0207707_11561028 Ga0207707_115610282 90
1633 3300025913 Ga0207695_10008130 Ga0207695_1000813012 90
1634 3300025913 Ga0207695_10016662 Ga0207695_1001666213 90
1635 3300025913 Ga0207695_10030817 Ga0207695_100308174 90
1636 3300025914 Ga0207671_10000021 Ga0207671_100000217 90
1637 3300025914 Ga0207671_10028839 Ga0207671_100288397 90
1638 3300025914 Ga0207671_10348938 Ga0207671_103489383 90
1639 3300025915 Ga0207693_10232042 Ga0207693_102320422 90
1640 3300025917 Ga0207660_10412099 Ga0207660_104120992 90
1641 3300025917 Ga0207660_10555426 Ga0207660_105554261 90
1642 3300025919 Ga0207657_10206470 Ga0207657_102064702 90
1643 3300025919 Ga0207657_11130317 Ga0207657_111303172 90
1644 3300025920 Ga0207649_10015186 Ga0207649_100151869 90
1645 3300025920 Ga0207649_10043228 Ga0207649_100432284 90
1646 3300025920 Ga0207649_10190994 Ga0207649_101909942 90
1647 3300025920 Ga0207649_10580892 Ga0207649_105808921 90
1648 3300025921 Ga0207652_10026548 Ga0207652_100265485 90
1649 3300025921 Ga0207652_10055937 Ga0207652_100559373 90
1650 3300025921 Ga0207652_10155814 Ga0207652_101558143 90
1651 3300025921 Ga0207652_10528373 Ga0207652_105283732 90
1652 3300025921 Ga0207652_11133565 Ga0207652_111335652 90
1653 3300025923 Ga0207681_10373981 Ga0207681_103739811 90
1654 3300025924 Ga0207694_10007361 Ga0207694_1000736117 90
1655 3300025924 Ga0207694_10016063 Ga0207694_100160637 90
1656 3300025924 Ga0207694_10017922 Ga0207694_1001792212 90
1657 3300025924 Ga0207694_10299943 Ga0207694_102999432 90
1658 3300025924 Ga0207694_10828510 Ga0207694_108285101 90
1659 3300025928 Ga0207700_10040493 Ga0207700_100404936 90
1660 3300025929 Ga0207664_10001884 Ga0207664_100018847 90
1661 3300025929 Ga0207664_10227762 Ga0207664_102277623 90
1662 3300025932 Ga0207690_10000291 Ga0207690_1000029125 90
1663 3300025932 Ga0207690_10068444 Ga0207690_100684444 90
1664 3300025932 Ga0207690_10427079 Ga0207690_104270792 90
1665 3300025933 Ga0207706_10066894 Ga0207706_100668944 90
1666 3300025936 Ga0207670_10008334 Ga0207670_1000833414 90
1667 3300025941 Ga0207711_10147290 Ga0207711_101472903 90
1668 3300025944 Ga0207661_11050282 Ga0207661_110502822 90
1669 3300025949 Ga0207667_10008135 Ga0207667_1000813523 90
1670 3300025949 Ga0207667_10034827 Ga0207667_100348275 90
1671 3300025949 Ga0207667_10053962 Ga0207667_100539627 90
1672 3300025949 Ga0207667_10054383 Ga0207667_1005438310 90
1673 3300025949 Ga0207667_10056014 Ga0207667_100560141 90
1674 3300025960 Ga0207651_11353849 Ga0207651_113538491 90
1675 3300025961 Ga0207712_10436855 Ga0207712_104368553 90
1676 3300025972 Ga0207668_10038934 Ga0207668_100389349 90
1677 3300025972 Ga0207668_10131935 Ga0207668_101319352 90
1678 3300025981 Ga0207640_10003058 Ga0207640_100030587 90
1679 3300025981 Ga0207640_10075585 Ga0207640_100755854 90
1680 3300025981 Ga0207640_10140937 Ga0207640_101409372 90
1681 3300025986 Ga0207658_10033742 Ga0207658_100337426 90
1682 3300025986 Ga0207658_10691454 Ga0207658_106914542 90
1683 3300026035 Ga0207703_10111336 Ga0207703_101113362 90
1684 3300026067 Ga0207678_10016758 Ga0207678_100167586 90
1685 3300026067 Ga0207678_10049236 Ga0207678_100492362 90
1686 3300026067 Ga0207678_10049696 Ga0207678_100496961 90
1687 3300026067 Ga0207678_10054333 Ga0207678_100543334 90
1688 3300026067 Ga0207678_10432553 Ga0207678_104325532 90
1689 3300026067 Ga0207678_10571163 Ga0207678_105711632 90
1690 3300026078 Ga0207702_10000517 Ga0207702_1000051727 90
1691 3300026078 Ga0207702_10000852 Ga0207702_1000085222 90
1692 3300026078 Ga0207702_10297203 Ga0207702_102972033 90
1693 3300026078 Ga0207702_10819141 Ga0207702_108191411 90
1694 3300026089 Ga0207648_10858932 Ga0207648_108589322 90
1695 3300026116 Ga0207674_10024573 Ga0207674_100245737 90
1696 3300026121 Ga0207683_10185736 Ga0207683_101857362 90
1697 3300026142 Ga0207698_10233124 Ga0207698_102331242 90
1698 3300028379 Ga0268266_10000021 Ga0268266_100000217 90
1699 3300028381 Ga0268264_10023204 Ga0268264_100232046 90
1700 3300028381 Ga0268264_10078261 Ga0268264_100782613 90
1701 3300030863 Ga0265766_1000157 Ga0265766_10001573 90
1702 3300030863 Ga0265766_1000678 Ga0265766_10006782 90
1703 3300030882 Ga0265764_100528 Ga0265764_1005282 90
1704 3300030888 Ga0265769_100077 Ga0265769_1000774 90
1705 3300030889 Ga0265761_100106 Ga0265761_1001062 90
1706 3300030963 Ga0265768_105590 Ga0265768_1055902 90
1707 3300031011 Ga0265774_100665 Ga0265774_1006652 90
1708 3300031238 Ga0265332_10043672 Ga0265332_100436721 90
1709 3300031250 Ga0265331_10185333 Ga0265331_101853332 90
1710 3300031251 Ga0265327_10001206 Ga0265327_100012067 90
1711 3300031251 Ga0265327_10016843 Ga0265327_100168432 90
1712 3300031251 Ga0265327_10072379 Ga0265327_100723791 90
1713 3300031344 Ga0265316_10013473 Ga0265316_100134737 90
1714 3300031665 Ga0316575_10003487 Ga0316575_1000348711 90
1715 3300031665 Ga0316575_10019997 Ga0316575_100199972 90
1716 3300031665 Ga0316575_10041167 Ga0316575_100411673 90
1717 3300031665 Ga0316575_10075551 Ga0316575_100755512 90
1718 3300031665 Ga0316575_10095476 Ga0316575_100954762 90
1719 3300031665 Ga0316575_10114305 Ga0316575_101143052 90
1720 3300031665 Ga0316575_10117423 Ga0316575_101174232 90
1721 3300031665 Ga0316575_10263197 Ga0316575_102631972 90
1722 3300031665 Ga0316575_10266994 Ga0316575_102669942 90
1723 3300031665 Ga0316575_10461904 Ga0316575_104619041 90
1724 3300031665 Ga0316575_10521875 Ga0316575_105218751 90
1725 3300031691 Ga0316579_10001358 Ga0316579_100013584 90
1726 3300031691 Ga0316579_10021458 Ga0316579_100214582 90
1727 3300031691 Ga0316579_10028133 Ga0316579_100281333 90
1728 3300031691 Ga0316579_10039853 Ga0316579_100398534 90
1729 3300031691 Ga0316579_10044157 Ga0316579_100441572 90
1730 3300031691 Ga0316579_10305886 Ga0316579_103058862 90
1731 3300031691 Ga0316579_10609697 Ga0316579_106096972 90
1732 3300031727 Ga0316576_10040497 Ga0316576_100404972 90
1733 3300031727 Ga0316576_10088414 Ga0316576_100884142 90
1734 3300031727 Ga0316576_10095795 Ga0316576_100957954 90
1735 3300031727 Ga0316576_10122358 Ga0316576_101223583 90
1736 3300031727 Ga0316576_10124049 Ga0316576_101240493 90
1737 3300031727 Ga0316576_10130986 Ga0316576_101309862 90
1738 3300031727 Ga0316576_10230284 Ga0316576_102302842 90
1739 3300031727 Ga0316576_10231450 Ga0316576_102314503 90
1740 3300031727 Ga0316576_10261846 Ga0316576_102618462 90
1741 3300031727 Ga0316576_10410576 Ga0316576_104105761 90
1742 3300031727 Ga0316576_10580574 Ga0316576_105805742 90
1743 3300031727 Ga0316576_10594817 Ga0316576_105948173 90
1744 3300031727 Ga0316576_10652730 Ga0316576_106527302 90
1745 3300031727 Ga0316576_10879301 Ga0316576_108793012 90
1746 3300031727 Ga0316576_10892595 Ga0316576_108925952 90
1747 3300031728 Ga0316578_10009045 Ga0316578_100090455 90
1748 3300031728 Ga0316578_10016369 Ga0316578_100163696 90
1749 3300031728 Ga0316578_10017845 Ga0316578_100178455 90
1750 3300031728 Ga0316578_10030344 Ga0316578_100303442 90
1751 3300031728 Ga0316578_10066185 Ga0316578_100661854 90
1752 3300031728 Ga0316578_10077313 Ga0316578_100773132 90
1753 3300031728 Ga0316578_10262275 Ga0316578_102622751 90
1754 3300031728 Ga0316578_10365080 Ga0316578_103650802 90
1755 3300031728 Ga0316578_10926696 Ga0316578_109266962 90
1756 3300031731 Ga0307405_10835403 Ga0307405_108354031 90
1757 3300031733 Ga0316577_10003697 Ga0316577_1000369713 90
1758 3300031733 Ga0316577_10007369 Ga0316577_100073696 90
1759 3300031733 Ga0316577_10010745 Ga0316577_100107458 90
1760 3300031733 Ga0316577_10018529 Ga0316577_100185299 90
1761 3300031733 Ga0316577_10024307 Ga0316577_100243072 90
1762 3300031733 Ga0316577_10054965 Ga0316577_100549653 90
1763 3300031733 Ga0316577_10160585 Ga0316577_101605852 90
1764 3300031733 Ga0316577_10194780 Ga0316577_101947802 90
1765 3300031733 Ga0316577_10217753 Ga0316577_102177532 90
1766 3300031733 Ga0316577_10400750 Ga0316577_104007501 90
1767 3300031733 Ga0316577_10541488 Ga0316577_105414882 90
1768 3300031733 Ga0316577_10827009 Ga0316577_108270092 90
1769 3300031824 Ga0307413_11635217 Ga0307413_116352171 90
1770 3300031911 Ga0307412_10019091 Ga0307412_100190916 90
1771 3300032133 Ga0316583_10013246 Ga0316583_100132465 90
1772 3300032133 Ga0316583_10028287 Ga0316583_100282873 90
1773 3300032133 Ga0316583_10029366 Ga0316583_100293664 90
1774 3300032133 Ga0316583_10038919 Ga0316583_100389193 90
1775 3300032133 Ga0316583_10148963 Ga0316583_101489632 90
1776 3300032137 Ga0316585_10004403 Ga0316585_100044031 90
1777 3300032137 Ga0316585_10005145 Ga0316585_100051457 90
1778 3300032137 Ga0316585_10117714 Ga0316585_101177142 90
1779 3300032139 Ga0316580_10006854 Ga0316580_100068542 90
1780 3300032139 Ga0316580_10011624 Ga0316580_100116243 90
1781 3300032139 Ga0316580_10031862 Ga0316580_100318622 90
1782 3300032139 Ga0316580_10083950 Ga0316580_100839502 90
1783 3300032139 Ga0316580_10159700 Ga0316580_101597002 90
1784 3300032139 Ga0316580_10176469 Ga0316580_101764691 90
1785 3300032139 Ga0316580_10190930 Ga0316580_101909301 90
1786 3300032168 Ga0316593_10000027 Ga0316593_1000002723 90
1787 3300032168 Ga0316593_10000032 Ga0316593_100000325 90
1788 3300032168 Ga0316593_10000037 Ga0316593_100000377 90
1789 3300032168 Ga0316593_10000049 Ga0316593_1000004922 90
1790 3300032168 Ga0316593_10000058 Ga0316593_1000005822 90
1791 3300032168 Ga0316593_10000111 Ga0316593_100001117 90
1792 3300032168 Ga0316593_10000520 Ga0316593_1000052016 90
1793 3300032168 Ga0316593_10001014 Ga0316593_100010142 90
1794 3300032168 Ga0316593_10001038 Ga0316593_100010385 90
1795 3300032168 Ga0316593_10001237 Ga0316593_1000123713 90
1796 3300032168 Ga0316593_10002148 Ga0316593_100021484 90
1797 3300032168 Ga0316593_10002233 Ga0316593_100022332 90
1798 3300032168 Ga0316593_10002520 Ga0316593_100025209 90
1799 3300032168 Ga0316593_10003055 Ga0316593_100030556 90
1800 3300032168 Ga0316593_10004408 Ga0316593_1000440810 90
1801 3300032168 Ga0316593_10005171 Ga0316593_100051717 90
1802 3300032168 Ga0316593_10005446 Ga0316593_100054462 90
1803 3300032168 Ga0316593_10005483 Ga0316593_100054835 90
1804 3300032168 Ga0316593_10007312 Ga0316593_100073126 90
1805 3300032168 Ga0316593_10023756 Ga0316593_100237564 90
1806 3300032168 Ga0316593_10057979 Ga0316593_100579791 90
1807 3300032168 Ga0316593_10129929 Ga0316593_101299291 90
1808 3300032168 Ga0316593_10135569 Ga0316593_101355693 90
1809 3300032168 Ga0316593_10143934 Ga0316593_101439343 90
1810 3300032168 Ga0316593_10195227 Ga0316593_101952272 90
1811 3300032168 Ga0316593_10249181 Ga0316593_102491812 90
1812 3300032168 Ga0316593_10258063 Ga0316593_102580631 90
1813 3300033180 Ga0307510_10002916 Ga0307510_1000291627 90
1814 3300033524 Ga0316592_1000006 Ga0316592_10000067 90
1815 3300033524 Ga0316592_1000009 Ga0316592_10000096 90
1816 3300033524 Ga0316592_1001866 Ga0316592_10018669 90
1817 3300033524 Ga0316592_1026467 Ga0316592_10264673 90
1818 3300033524 Ga0316592_1057054 Ga0316592_10570543 90
1819 3300033524 Ga0316592_1061334 Ga0316592_10613342 90
1820 3300033524 Ga0316592_1086705 Ga0316592_10867051 90
1821 3300033524 Ga0316592_1137312 Ga0316592_11373121 90
1822 3300033524 Ga0316592_1176847 Ga0316592_11768472 90
1823 3300033527 Ga0316586_1000040 Ga0316586_100004014 90
1824 3300033527 Ga0316586_1000155 Ga0316586_100015514 90
1825 3300033527 Ga0316586_1000232 Ga0316586_10002322 90
1826 3300033527 Ga0316586_1041976 Ga0316586_10419761 90
1827 3300033527 Ga0316586_1079238 Ga0316586_10792382 90
1828 3300033527 Ga0316586_1084892 Ga0316586_10848922 90
1829 3300033527 Ga0316586_1089341 Ga0316586_10893411 90
1830 3300033527 Ga0316586_1118603 Ga0316586_11186032 90
1831 3300033528 Ga0316588_1001236 Ga0316588_10012367 90
1832 3300033528 Ga0316588_1002450 Ga0316588_10024502 90
1833 3300033528 Ga0316588_1020411 Ga0316588_10204113 90
1834 3300033528 Ga0316588_1089840 Ga0316588_10898402 90
1835 3300033528 Ga0316588_1097995 Ga0316588_10979951 90
1836 3300033528 Ga0316588_1107268 Ga0316588_11072681 90
1837 3300033528 Ga0316588_1111935 Ga0316588_11119352 90
1838 3300033528 Ga0316588_1126595 Ga0316588_11265952 90
1839 3300033529 Ga0316587_1000021 Ga0316587_10000217 90
1840 3300033529 Ga0316587_1000243 Ga0316587_10002434 90
1841 3300033529 Ga0316587_1009371 Ga0316587_10093712 90
1842 3300033529 Ga0316587_1013103 Ga0316587_10131034 90
1843 3300033529 Ga0316587_1033742 Ga0316587_10337422 90
1844 3300033529 Ga0316587_1041422 Ga0316587_10414222 90
1845 3300033529 Ga0316587_1044604 Ga0316587_10446042 90
1846 3300033529 Ga0316587_1045255 Ga0316587_10452552 90
1847 3300033529 Ga0316587_1064554 Ga0316587_10645541 90
1848 3300033529 Ga0316587_1092801 Ga0316587_10928012 90
1849 3300033529 Ga0316587_1116010 Ga0316587_11160102 90
1850 3300033529 Ga0316587_1125893 Ga0316587_11258932 90
1851 3300033541 Ga0316596_1000016 Ga0316596_100001623 90
1852 3300033541 Ga0316596_1000037 Ga0316596_100003722 90
1853 3300033541 Ga0316596_1000040 Ga0316596_100004023 90
1854 3300033541 Ga0316596_1000061 Ga0316596_10000613 90
1855 3300033541 Ga0316596_1000222 Ga0316596_100022212 90
1856 3300033541 Ga0316596_1000323 Ga0316596_10003237 90
1857 3300033541 Ga0316596_1000395 Ga0316596_10003957 90
1858 3300033541 Ga0316596_1000524 Ga0316596_100052410 90
1859 3300033541 Ga0316596_1000651 Ga0316596_100065114 90
1860 3300033541 Ga0316596_1000864 Ga0316596_100086410 90
1861 3300033541 Ga0316596_1000880 Ga0316596_100088012 90
1862 3300033541 Ga0316596_1001420 Ga0316596_10014203 90
1863 3300033541 Ga0316596_1002164 Ga0316596_100216411 90
1864 3300033541 Ga0316596_1002852 Ga0316596_10028527 90
1865 3300033541 Ga0316596_1003697 Ga0316596_10036972 90
1866 3300033541 Ga0316596_1008032 Ga0316596_10080323 90
1867 3300033541 Ga0316596_1008327 Ga0316596_10083274 90
1868 3300033541 Ga0316596_1008767 Ga0316596_10087672 90
1869 3300033541 Ga0316596_1009728 Ga0316596_10097284 90
1870 3300033541 Ga0316596_1026342 Ga0316596_10263422 90
1871 3300033541 Ga0316596_1030126 Ga0316596_10301263 90
1872 3300033541 Ga0316596_1063707 Ga0316596_10637072 90
1873 3300033541 Ga0316596_1063753 Ga0316596_10637531 90
1874 3300033541 Ga0316596_1074731 Ga0316596_10747312 90
1875 3300033541 Ga0316596_1103989 Ga0316596_11039892 90
1876 3300035398 Ga0316574_0001182 Ga0316574_0001182_1890_2162 90
1877 3300035398 Ga0316574_0001517 Ga0316574_0001517_10071_10343 90
1878 3300035398 Ga0316574_0004866 Ga0316574_0004866_2827_3099 90
1879 3300035398 Ga0316574_0005225 Ga0316574_0005225_3690_3968 90
1880 3300035398 Ga0316574_0006168 Ga0316574_0006168_5666_5938 90
1881 3300035398 Ga0316574_0010022 Ga0316574_0010022_2362_2634 90
1882 3300035398 Ga0316574_0018187 Ga0316574_0018187_909_1181 90
1883 3300035398 Ga0316574_0018286 Ga0316574_0018286_1983_2255 90
1884 3300035398 Ga0316574_0019286 Ga0316574_0019286_497_769 90
1885 3300035398 Ga0316574_0033688 Ga0316574_0033688_2210_2482 90
1886 3300035398 Ga0316574_0083922 Ga0316574_0083922_1035_1307 90
1887 3300035398 Ga0316574_0121691 Ga0316574_0121691_738_1010 90
1888 3300035398 Ga0316574_0131023 Ga0316574_0131023_880_1152 90
1889 3300035398 Ga0316574_0152524 Ga0316574_0152524_823_1095 90
1890 3300035398 Ga0316574_0263585 Ga0316574_0263585_770_1042 90
1891 3300035398 Ga0316574_0456229 Ga0316574_0456229_170_442 90
1892 3300035398 Ga0316574_0654876 Ga0316574_0654876_122_394 90
1893 3300035398 Ga0316574_0929972 Ga0316574_0929972_41_313 90
1894 3300036458 Ga0310112_000276 Ga0310112_000276_664_936 90
1895 3300036534 Ga0310109_032224 Ga0310109_032224_152_424 90
1896 3300036535 Ga0310110_006942 Ga0310110_006942_475_747 90
1897 3300036647 Ga0316582_0000535 Ga0316582_0000535_12699_12971 90
1898 3300036647 Ga0316582_0001466 Ga0316582_0001466_3055_3327 90
1899 3300036647 Ga0316582_0004346 Ga0316582_0004346_348_620 90
1900 3300036647 Ga0316582_0006754 Ga0316582_0006754_1768_2040 90
1901 3300036647 Ga0316582_0016951 Ga0316582_0016951_2907_3179 90
1902 3300036647 Ga0316582_0024855 Ga0316582_0024855_1192_1464 90
1903 3300036647 Ga0316582_0034174 Ga0316582_0034174_55_327 90
1904 3300036647 Ga0316582_0073333 Ga0316582_0073333_1596_1868 90
1905 3300036647 Ga0316582_0076209 Ga0316582_0076209_1289_1561 90
1906 3300036647 Ga0316582_0077411 Ga0316582_0077411_1388_1660 90
1907 3300036647 Ga0316582_0165274 Ga0316582_0165274_643_921 90
1908 3300036647 Ga0316582_0216723 Ga0316582_0216723_66_338 90
1909 3300036647 Ga0316582_0260869 Ga0316582_0260869_845_1117 90
1910 3300036647 Ga0316582_0277956 Ga0316582_0277956_781_1053 90
1911 3300036647 Ga0316582_0300986 Ga0316582_0300986_156_428 90
1912 3300036647 Ga0316582_0322039 Ga0316582_0322039_307_579 90
1913 3300036647 Ga0316582_0750522 Ga0316582_0750522_223_495 90
1914 3300036712 Ga0316584_0002043 Ga0316584_0002043_9050_9322 90
1915 3300036712 Ga0316584_0004999 Ga0316584_0004999_7302_7574 90
1916 3300036712 Ga0316584_0015064 Ga0316584_0015064_177_449 90
1917 3300036712 Ga0316584_0018774 Ga0316584_0018774_4207_4479 90
1918 3300036712 Ga0316584_0023344 Ga0316584_0023344_2817_3089 90
1919 3300036712 Ga0316584_0046768 Ga0316584_0046768_2805_3077 90
1920 3300036712 Ga0316584_0116154 Ga0316584_0116154_1621_1893 90
1921 3300036712 Ga0316584_0124219 Ga0316584_0124219_1561_1833 90
1922 3300036712 Ga0316584_0133805 Ga0316584_0133805_1534_1806 90
1923 3300036712 Ga0316584_0259057 Ga0316584_0259057_92_364 90
1924 3300036712 Ga0316584_0272749 Ga0316584_0272749_716_988 90
1925 3300036712 Ga0316584_0278893 Ga0316584_0278893_496_768 90
1926 3300036712 Ga0316584_0286693 Ga0316584_0286693_572_844 90
1927 3300036712 Ga0316584_0362623 Ga0316584_0362623_550_822 90
1928 3300036712 Ga0316584_0370650 Ga0316584_0370650_201_473 90
1929 3300036712 Ga0316584_0533874 Ga0316584_0533874_162_434 90
1930 3300036712 Ga0316584_0806644 Ga0316584_0806644_250_522 90
1931 3300037312 Ga0395899_0001959 Ga0395899_0001959_13178_13450 90
1932 3300037312 Ga0395899_0012521 Ga0395899_0012521_3241_3513 90
1933 3300037312 Ga0395899_0022053 Ga0395899_0022053_2465_2737 90
1934 3300037418 Ga0395900_0000012 Ga0395900_0000012_45174_45446 90
1935 3300037418 Ga0395900_0569240 Ga0395900_0569240_273_545 90
1936 3300037418 Ga0395900_0729578 Ga0395900_0729578_566_838 90
1937 3300037466 Ga0395898_0000558 Ga0395898_0000558_3457_3729 90
1938 3300037466 Ga0395898_0000600 Ga0395898_0000600_3263_3535 90
1939 3300037466 Ga0395898_0006608 Ga0395898_0006608_10247_10519 90
1940 3300037466 Ga0395898_0045474 Ga0395898_0045474_307_579 90
1941 3300037466 Ga0395898_0519383 Ga0395898_0519383_494_766 90
1942 3300037471 Ga0395905_0110422 Ga0395905_0110422_1674_1946 90
1943 3300037588 Ga0316581_0001208 Ga0316581_0001208_2922_3194 90
1944 3300037588 Ga0316581_0005787 Ga0316581_0005787_100_372 90
1945 3300037588 Ga0316581_0009007 Ga0316581_0009007_1628_1900 90
1946 3300037588 Ga0316581_0046234 Ga0316581_0046234_310_582 90
1947 3300038443 Ga0395901_0002939 Ga0395901_0002939_3401_3673 90
1948 3300038443 Ga0395901_0011584 Ga0395901_0011584_3302_3574 90
1949 3300038443 Ga0395901_0075079 Ga0395901_0075079_2337_2609 90
1950 3300038443 Ga0395901_0636669 Ga0395901_0636669_435_707 90
1951 3300038726 Ga0400490_39901 Ga0400490_39901_2967_3239 90
1952 3300038727 Ga0400491_25146 Ga0400491_25146_263_535 90
1953 3300038727 Ga0400491_26818 Ga0400491_26818_623_895 90
1954 3300038735 Ga0400485_07280 Ga0400485_07280_1022_1294 90
1955 3300038741 Ga0400488_55051 Ga0400488_55051_839_1111 90
1956 3300038742 Ga0400486_26826 Ga0400486_26826_1202_1474 90
1957 3300039062 Ga0400483_140144 Ga0400483_140144_3505_3777 90
1958 3300039062 Ga0400483_140808 Ga0400483_140808_796_1068 90
1959 3300039062 Ga0400483_211411 Ga0400483_211411_5414_5686 90
1960 3300039093 Ga0400489_34148 Ga0400489_34148_3318_3590 90
1961 3300039110 Ga0400487_09422 Ga0400487_09422_224_496 90
1962 3300039110 Ga0400487_29008 Ga0400487_29008_2906_3178 90
1963 3300039110 Ga0400487_43302 Ga0400487_43302_334_606 90
1964 3300039447 Ga0436361_0507941 Ga0436361_0507941_258_530 90
1965 3300041404 Ga0439436_0000027 Ga0439436_0000027_47172_47444 90
1966 3300041413 Ga0439465_0000141 Ga0439465_0000141_4042_4314 90
1967 3300041446 Ga0451794_16517 Ga0451794_16517_419_691 90
1968 3300041452 Ga0451793_0393032 Ga0451793_0393032_3224_3496 90
1969 3300041453 Ga0451797_1067951 Ga0451797_1067951_273_548 90
1970 3300041456 Ga0451795_0084050 Ga0451795_0084050_592_864 90
1971 3300042000 Ga0439437_013355 Ga0439437_013355_335_607 90
1972 3300042005 Ga0439448_0025446 Ga0439448_0025446_513_785 90
1973 3300042005 Ga0439448_0026596 Ga0439448_0026596_1373_1645 90
1974 3300042006 Ga0439432_111580 Ga0439432_111580_222_494 90
1975 3300042011 Ga0439454_012464 Ga0439454_012464_264_536 90
1976 3300042013 Ga0439456_082063 Ga0439456_082063_230_502 90
1977 3300042157 Ga0439458_0051278 Ga0439458_0051278_208_480 90
1978 3300042184 Ga0450908_002828 Ga0450908_002828_614_886 90
1979 3300042438 Ga0439459_0003452 Ga0439459_0003452_618_890 90
1980 3300044656 Ga0466969_0008348 Ga0466969_0008348_3311_3583 90
1981 3300044656 Ga0466969_0008941 Ga0466969_0008941_1892_2164 90
1982 3300044656 Ga0466969_0342776 Ga0466969_0342776_322_594 90
1983 3300044658 Ga0466972_0122579 Ga0466972_0122579_427_699 90
1984 3300044672 Ga0466982_0000005 Ga0466982_0000005_98169_98441 90
1985 3300044672 Ga0466982_0000210 Ga0466982_0000210_11518_11790 90
1986 3300044683 Ga0466965_0003853 Ga0466965_0003853_3647_3919 90
1987 3300044683 Ga0466965_0022934 Ga0466965_0022934_1371_1643 90
1988 3300044684 Ga0466966_0002549 Ga0466966_0002549_3248_3520 90
1989 3300044684 Ga0466966_0048560 Ga0466966_0048560_1398_1670 90
1990 3300044693 Ga0466961_0010336 Ga0466961_0010336_2032_2304 90
1991 3300044693 Ga0466961_0015293 Ga0466961_0015293_2749_3021 90
1992 3300044693 Ga0466961_0082193 Ga0466961_0082193_1428_1700 90
1993 3300044693 Ga0466961_0808313 Ga0466961_0808313_94_366 90
1994 3300044694 Ga0466963_1255173 Ga0466963_1255173_130_402 90
1995 3300044706 Ga0466964_0006055 Ga0466964_0006055_607_879 90
1996 3300044706 Ga0466964_0260014 Ga0466964_0260014_20_292 90
1997 3300044712 Ga0453684_0009574 Ga0453684_0009574_8534_8806 90
1998 3300044719 Ga0466971_0000338 Ga0466971_0000338_7904_8176 90
1999 3300044719 Ga0466971_0006109 Ga0466971_0006109_3253_3525 90
2000 3300044719 Ga0466971_0029817 Ga0466971_0029817_1844_2116 90
2001 3300044719 Ga0466971_0131518 Ga0466971_0131518_33_305 90
2002 3300044719 Ga0466971_0178935 Ga0466971_0178935_198_470 90
2003 3300044735 Ga0466968_0000409 Ga0466968_0000409_11962_12234 90
2004 3300044735 Ga0466968_0012570 Ga0466968_0012570_72_344 90
2005 3300044735 Ga0466968_0036755 Ga0466968_0036755_198_470 90
2006 3300044765 Ga0466970_0001896 Ga0466970_0001896_3223_3495 90
2007 3300044765 Ga0466970_0170899 Ga0466970_0170899_839_1111 90
2008 3300044842 Ga0466957_0003550 Ga0466957_0003550_6597_6869 90
2009 3300044842 Ga0466957_0019946 Ga0466957_0019946_1928_2200 90
2010 3300044842 Ga0466957_0036522 Ga0466957_0036522_1270_1542 90
2011 3300044842 Ga0466957_1189222 Ga0466957_1189222_268_540 90
2012 3300044901 Ga0466960_0002345 Ga0466960_0002345_3248_3520 90
2013 3300045049 Ga0466959_0025211 Ga0466959_0025211_3250_3522 90
2014 3300045049 Ga0466959_0033759 Ga0466959_0033759_3272_3544 90
2015 3300045049 Ga0466959_0043319 Ga0466959_0043319_2279_2551 90
2016 3300045051 Ga0451576_0018551 Ga0451576_0018551_5175_5447 90
2017 3300045836 Ga0466958_0005279 Ga0466958_0005279_3247_3519 90
2018 3300045976 Ga0466967_0090561 Ga0466967_0090561_1307_1579 90
2019 3300045976 Ga0466967_0163633 Ga0466967_0163633_1595_1867 90
2020 3300045976 Ga0466967_1556056 Ga0466967_1556056_280_552 90
2021 3300046452 Ga0495617_005550 Ga0495617_005550_1659_1931 90
2022 3300046460 Ga0495638_0000007 Ga0495638_0000007_598152_598424 90
2023 3300046460 Ga0495638_0006581 Ga0495638_0006581_8083_8355 90
2024 3300046460 Ga0495638_0055083 Ga0495638_0055083_406_678 90
2025 3300046471 Ga0495650_0000202 Ga0495650_0000202_14221_14493 90
2026 3300046471 Ga0495650_0011898 Ga0495650_0011898_2870_3142 90
2027 3300046471 Ga0495650_0030472 Ga0495650_0030472_310_582 90
2028 3300046474 Ga0495605_0139180 Ga0495605_0139180_252_524 90
2029 3300046491 Ga0495584_0001537 Ga0495584_0001537_12527_12799 90
2030 3300046492 Ga0495585_0013800 Ga0495585_0013800_892_1164 90
2031 3300046492 Ga0495585_0141188 Ga0495585_0141188_892_1164 90
2032 3300046501 Ga0495607_0007223 Ga0495607_0007223_2963_3235 90
2033 3300046501 Ga0495607_0043874 Ga0495607_0043874_1659_1931 90
2034 3300046506 Ga0495583_0012059 Ga0495583_0012059_1372_1644 90
2035 3300046507 Ga0495606_0001329 Ga0495606_0001329_29986_30258 90
2036 3300046507 Ga0495606_0034951 Ga0495606_0034951_1569_1841 90
2037 3300046507 Ga0495606_0061245 Ga0495606_0061245_437_709 90
2038 3300046512 Ga0495610_0001380 Ga0495610_0001380_20367_20639 90
2039 3300046512 Ga0495610_0045466 Ga0495610_0045466_1362_1634 90
2040 3300046513 Ga0495616_0007049 Ga0495616_0007049_3460_3732 90
2041 3300046515 Ga0495620_0015281 Ga0495620_0015281_710_982 90
2042 3300046518 Ga0495631_0372831 Ga0495631_0372831_66_338 90
2043 3300046519 Ga0495632_0005327 Ga0495632_0005327_3341_3613 90
2044 3300046519 Ga0495632_0019213 Ga0495632_0019213_26_298 90
2045 3300046519 Ga0495632_0158223 Ga0495632_0158223_102_374 90
2046 3300046520 Ga0495637_0009169 Ga0495637_0009169_520_792 90
2047 3300046522 Ga0495643_0018809 Ga0495643_0018809_482_754 90
2048 3300046524 Ga0495648_0013709 Ga0495648_0013709_874_1146 90
2049 3300046538 Ga0495609_0001578 Ga0495609_0001578_11218_11490 90
2050 3300046539 Ga0495621_0148177 Ga0495621_0148177_380_682 90
2051 3300046557 Ga0495622_0008281 Ga0495622_0008281_1479_1751 90
2052 3300046557 Ga0495622_0282969 Ga0495622_0282969_362_634 90
2053 3300046616 Ga0495668_0021331 Ga0495668_0021331_1601_1873 90
2054 3300046648 Ga0495611_0000029 Ga0495611_0000029_102520_102792 90
2055 3300046660 Ga0495625_0001724 Ga0495625_0001724_13096_13368 90
2056 3300046660 Ga0495625_0016676 Ga0495625_0016676_3776_4048 90
2057 3300046660 Ga0495625_0040795 Ga0495625_0040795_996_1268 90
2058 3300046665 Ga0495661_0008049 Ga0495661_0008049_3454_3726 90
2059 3300046683 Ga0495658_0374067 Ga0495658_0374067_175_474 90
2060 3300046691 Ga0495670_0039605 Ga0495670_0039605_289_561 90
2061 3300046691 Ga0495670_0049122 Ga0495670_0049122_987_1259 90
2062 3300046692 Ga0495671_0005114 Ga0495671_0005114_3584_3856 90
2063 3300046692 Ga0495671_0153520 Ga0495671_0153520_470_742 90
2064 3300046694 Ga0495649_0000383 Ga0495649_0000383_3692_3964 90
2065 3300046694 Ga0495649_0006659 Ga0495649_0006659_2520_2792 90
2066 3300046794 Ga0495589_0000144 Ga0495589_0000144_20746_21018 90
2067 3300046810 Ga0495660_0003242 Ga0495660_0003242_6383_6655 90
2068 3300046810 Ga0495660_0270645 Ga0495660_0270645_483_764 90
2069 3300047323 Ga0495683_0004657 Ga0495683_0004657_3885_4157 90
2070 3300047446 Ga0495679_000001 Ga0495679_000001_1603806_1604078 90
2071 3300047469 Ga0495673_0004383 Ga0495673_0004383_3903_4175 90
2072 3300047469 Ga0495673_0005855 Ga0495673_0005855_3627_3899 90
2073 3300047470 Ga0495681_0082740 Ga0495681_0082740_736_1008 90
2074 3300047472 Ga0495686_0002623 Ga0495686_0002623_3303_3575 90
2075 3300048090 Ga0495615_0251764 Ga0495615_0251764_231_503 90
2076 3300048903 Ga0496100_0006795 Ga0496100_0006795_2676_2948 90
2077 3300048904 Ga0496101_0009854 Ga0496101_0009854_2401_2673 90
2078 3300048904 Ga0496101_0103046 Ga0496101_0103046_1760_2032 90
2079 3300048905 Ga0496102_0048305 Ga0496102_0048305_2367_2639 90
2080 3300048905 Ga0496102_0402742 Ga0496102_0402742_461_733 90
2081 3300048906 Ga0496103_0423024 Ga0496103_0423024_479_751 90
2082 3300048907 Ga0496104_0045988 Ga0496104_0045988_1985_2257 90
2083 3300048907 Ga0496104_1052529 Ga0496104_1052529_335_607 90
2084 3300048908 Ga0496105_0041905 Ga0496105_0041905_3157_3429 90
2085 3300048909 Ga0496106_0008692 Ga0496106_0008692_1361_1633 90
2086 3300048909 Ga0496106_0031025 Ga0496106_0031025_2506_2778 90
2087 3300048909 Ga0496106_0249714 Ga0496106_0249714_81_353 90
2088 3300048909 Ga0496106_0572568 Ga0496106_0572568_308_580 90
2089 3300048910 Ga0496107_0034298 Ga0496107_0034298_2027_2299 90
2090 3300048910 Ga0496107_0181248 Ga0496107_0181248_590_862 90
2091 3300048915 Ga0496112_0198029 Ga0496112_0198029_1092_1364 90
2092 3300048916 Ga0496113_0029185 Ga0496113_0029185_3054_3326 90
2093 3300048917 Ga0496114_0058872 Ga0496114_0058872_436_708 90
2094 3300048918 Ga0496115_0002269 Ga0496115_0002269_10181_10453 90
2095 3300048918 Ga0496115_0027172 Ga0496115_0027172_3032_3304 90
2096 3300048918 Ga0496115_0375664 Ga0496115_0375664_742_1014 90
2097 3300048919 Ga0496116_0059595 Ga0496116_0059595_231_503 90
2098 3300048919 Ga0496116_0143319 Ga0496116_0143319_106_378 90
2099 3300048919 Ga0496116_0200234 Ga0496116_0200234_486_758 90
2100 3300048920 Ga0496117_0050487 Ga0496117_0050487_1680_1952 90
2101 3300048920 Ga0496117_0108977 Ga0496117_0108977_599_871 90
2102 3300048921 Ga0496118_0012660 Ga0496118_0012660_307_579 90
2103 3300048921 Ga0496118_0024725 Ga0496118_0024725_3023_3295 90
2104 3300048921 Ga0496118_0206013 Ga0496118_0206013_305_577 90
2105 3300048921 Ga0496118_0395792 Ga0496118_0395792_141_413 90
2106 3300048922 Ga0496119_0014507 Ga0496119_0014507_2263_2535 90
2107 3300048922 Ga0496119_0016519 Ga0496119_0016519_3624_3896 90
2108 3300048923 Ga0496120_0005412 Ga0496120_0005412_8255_8527 90
2109 3300048923 Ga0496120_0219800 Ga0496120_0219800_504_776 90
2110 3300048924 Ga0496121_0000290 Ga0496121_0000290_8564_8836 90
2111 3300048924 Ga0496121_0016314 Ga0496121_0016314_4457_4729 90
2112 3300048924 Ga0496121_0034268 Ga0496121_0034268_2860_3132 90
2113 3300048924 Ga0496121_0042451 Ga0496121_0042451_158_430 90
2114 3300048924 Ga0496121_0053526 Ga0496121_0053526_31_303 90
2115 3300048924 Ga0496121_0090388 Ga0496121_0090388_1284_1556 90
2116 3300048925 Ga0496122_0060605 Ga0496122_0060605_1985_2257 90
2117 3300048925 Ga0496122_0101542 Ga0496122_0101542_184_456 90
2118 3300048925 Ga0496122_0177135 Ga0496122_0177135_478_750 90
2119 3300048925 Ga0496122_0212039 Ga0496122_0212039_44_316 90
2120 3300048926 Ga0496123_0024610 Ga0496123_0024610_3963_4235 90
2121 3300048926 Ga0496123_0083888 Ga0496123_0083888_306_578 90
2122 3300048927 Ga0496124_0000472 Ga0496124_0000472_3440_3712 90
2123 3300048928 Ga0496125_0000379 Ga0496125_0000379_79607_79879 90
2124 3300048928 Ga0496125_0024621 Ga0496125_0024621_2130_2402 90
2125 3300048928 Ga0496125_0062554 Ga0496125_0062554_1591_1863 90
2126 3300048929 Ga0496126_0006212 Ga0496126_0006212_10026_10298 90
2127 3300048929 Ga0496126_0007636 Ga0496126_0007636_1745_2017 90
2128 3300048929 Ga0496126_0028743 Ga0496126_0028743_3928_4200 90
2129 3300048929 Ga0496126_0243418 Ga0496126_0243418_143_415 90
2130 3300048986 Ga0466983_0533056 Ga0466983_0533056_408_680 90
2131 3300049160 Ga0501304_009401 Ga0501304_009401_25_297 90
2132 3300049162 Ga0501307_009289 Ga0501307_009289_534_806 90
2133 3300049459 Ga0495678_004567 Ga0495678_004567_4101_4373 90
2134 3300049459 Ga0495678_016742 Ga0495678_016742_244_516 90
2135 3300049460 Ga0495682_0066105 Ga0495682_0066105_256_528 90
2136 3300049568 Ga0501031_0049682 Ga0501031_0049682_1411_1683 90
2137 3300049568 Ga0501031_0477891 Ga0501031_0477891_398_670 90
2138 3300049568 Ga0501031_0606696 Ga0501031_0606696_14_286 90
2139 3300049568 Ga0501031_0768878 Ga0501031_0768878_260_547 90
2140 3300049569 Ga0501032_0025237 Ga0501032_0025237_558_830 90
2141 3300049569 Ga0501032_0056009 Ga0501032_0056009_112_384 90
2142 3300049569 Ga0501032_0080851 Ga0501032_0080851_1025_1297 90
2143 3300049570 Ga0501033_0014950 Ga0501033_0014950_2411_2683 90
2144 3300049570 Ga0501033_0017913 Ga0501033_0017913_3012_3299 90
2145 3300049570 Ga0501033_0080095 Ga0501033_0080095_950_1222 90
2146 3300049570 Ga0501033_0147652 Ga0501033_0147652_1281_1553 90
2147 3300049570 Ga0501033_0216756 Ga0501033_0216756_899_1171 90
2148 3300049570 Ga0501033_0532740 Ga0501033_0532740_30_302 90
2149 3300049571 Ga0501034_0008263 Ga0501034_0008263_7475_7747 90
2150 3300049571 Ga0501034_0010161 Ga0501034_0010161_6649_6921 90
2151 3300049571 Ga0501034_0192626 Ga0501034_0192626_293_565 90
2152 3300049571 Ga0501034_0209790 Ga0501034_0209790_626_898 90
2153 3300049571 Ga0501034_0403009 Ga0501034_0403009_331_603 90
2154 3300049572 Ga0501036_0068501 Ga0501036_0068501_69_341 90
2155 3300049572 Ga0501036_0084334 Ga0501036_0084334_780_1052 90
2156 3300049572 Ga0501036_0147118 Ga0501036_0147118_306_578 90
2157 3300049572 Ga0501036_0292945 Ga0501036_0292945_269_541 90
2158 3300049573 Ga0501037_0021042 Ga0501037_0021042_1559_1831 90
2159 3300049573 Ga0501037_0282726 Ga0501037_0282726_303_575 90
2160 3300049573 Ga0501037_0314761 Ga0501037_0314761_724_996 90
2161 3300049574 Ga0501038_0005917 Ga0501038_0005917_5931_6203 90
2162 3300049574 Ga0501038_0013134 Ga0501038_0013134_3930_4202 90
2163 3300049574 Ga0501038_0059410 Ga0501038_0059410_2700_2987 90
2164 3300049574 Ga0501038_0076438 Ga0501038_0076438_2309_2581 90
2165 3300049575 Ga0501039_0108800 Ga0501039_0108800_670_942 90
2166 3300049575 Ga0501039_0123447 Ga0501039_0123447_979_1251 90
2167 3300049577 Ga0501041_0259926 Ga0501041_0259926_343_615 90
2168 3300049578 Ga0501042_0466993 Ga0501042_0466993_88_360 90
2169 3300049579 Ga0501043_0004937 Ga0501043_0004937_8331_8603 90
2170 3300049579 Ga0501043_0016278 Ga0501043_0016278_3240_3512 90
2171 3300049579 Ga0501043_0171694 Ga0501043_0171694_136_408 90
2172 3300049579 Ga0501043_0179483 Ga0501043_0179483_710_997 90
2173 3300049579 Ga0501043_0281565 Ga0501043_0281565_403_675 90
2174 3300049580 Ga0501046_0015318 Ga0501046_0015318_2902_3174 90
2175 3300049580 Ga0501046_0034206 Ga0501046_0034206_303_575 90
2176 3300049580 Ga0501046_0077141 Ga0501046_0077141_834_1115 90
2177 3300049580 Ga0501046_0174084 Ga0501046_0174084_994_1266 90
2178 3300049580 Ga0501046_0353049 Ga0501046_0353049_484_771 90
2179 3300049580 Ga0501046_0851172 Ga0501046_0851172_274_546 90
2180 3300049581 Ga0501047_0135727 Ga0501047_0135727_1876_2148 90
2181 3300049581 Ga0501047_0165041 Ga0501047_0165041_1441_1728 90
2182 3300049581 Ga0501047_0173969 Ga0501047_0173969_1124_1396 90
2183 3300049581 Ga0501047_0219719 Ga0501047_0219719_831_1103 90
2184 3300049581 Ga0501047_0322832 Ga0501047_0322832_415_696 90
2185 3300049582 Ga0501048_0021518 Ga0501048_0021518_1342_1614 90
2186 3300049582 Ga0501048_0168984 Ga0501048_0168984_241_513 90
2187 3300049583 Ga0501067_0071749 Ga0501067_0071749_902_1174 90
2188 3300049585 Ga0501069_0245209 Ga0501069_0245209_71_358 90
2189 3300049585 Ga0501069_0311276 Ga0501069_0311276_629_901 90
2190 3300049586 Ga0501070_0038865 Ga0501070_0038865_151_423 90
2191 3300049586 Ga0501070_0041063 Ga0501070_0041063_3155_3427 90
2192 3300049586 Ga0501070_0152670 Ga0501070_0152670_1066_1338 90
2193 3300049586 Ga0501070_0285297 Ga0501070_0285297_584_871 90
2194 3300049586 Ga0501070_0561279 Ga0501070_0561279_411_683 90
2195 3300049588 Ga0501072_0311623 Ga0501072_0311623_278_550 90
2196 3300049589 Ga0501073_0008863 Ga0501073_0008863_6621_6893 90
2197 3300049589 Ga0501073_0062427 Ga0501073_0062427_1404_1691 90
2198 3300049590 Ga0501074_0029861 Ga0501074_0029861_909_1196 90
2199 3300049590 Ga0501074_0040153 Ga0501074_0040153_2939_3211 90
2200 3300049590 Ga0501074_0097830 Ga0501074_0097830_909_1196 90
2201 3300049705 Ga0501225_0085336 Ga0501225_0085336_474_746 90
2202 3300049741 Ga0501079_0140789 Ga0501079_0140789_56_328 90
2203 3300049741 Ga0501079_0466944 Ga0501079_0466944_331_618 90
2204 3300049742 Ga0501080_0011521 Ga0501080_0011521_3151_3423 90
2205 3300049742 Ga0501080_0021405 Ga0501080_0021405_2707_2994 90
2206 3300049742 Ga0501080_0036209 Ga0501080_0036209_2836_3108 90
2207 3300049742 Ga0501080_0075188 Ga0501080_0075188_2476_2757 90
2208 3300049742 Ga0501080_0634277 Ga0501080_0634277_583_855 90
2209 3300049744 Ga0501083_0018874 Ga0501083_0018874_1509_1781 90
2210 3300049822 Ga0501035_0021041 Ga0501035_0021041_5377_5649 90
2211 3300049822 Ga0501035_0043348 Ga0501035_0043348_2838_3110 90
2212 3300049822 Ga0501035_0043368 Ga0501035_0043368_927_1199 90
2213 3300049822 Ga0501035_0055245 Ga0501035_0055245_2359_2646 90
2214 3300049822 Ga0501035_0109734 Ga0501035_0109734_635_907 90
2215 3300049822 Ga0501035_0171448 Ga0501035_0171448_1322_1594 90
2216 3300049822 Ga0501035_0898811 Ga0501035_0898811_143_415 90
2217 3300049823 Ga0501044_0036733 Ga0501044_0036733_1603_1875 90
2218 3300049823 Ga0501044_0043547 Ga0501044_0043547_3476_3763 90
2219 3300049823 Ga0501044_0053687 Ga0501044_0053687_601_873 90
2220 3300049823 Ga0501044_0070126 Ga0501044_0070126_3104_3376 90
2221 3300049823 Ga0501044_0409970 Ga0501044_0409970_397_669 90
2222 3300049824 Ga0501045_0285322 Ga0501045_0285322_830_1102 90
2223 3300050493 nmdc:mga0k408_717214_c1 nmdc:mga0k408_717214_c1_253_525 90
2224 3300050511 nmdc:mga08y16_740964_c1 nmdc:mga08y16_740964_c1_417_719 90
2225 3300050513 nmdc:mga0rr50_660293_c1 nmdc:mga0rr50_660293_c1_549_839 90
2226 3300050516 nmdc:mga0sz30_144290_c1 nmdc:mga0sz30_144290_c1_591_863 90
2227 3300050516 nmdc:mga0sz30_381982_c1 nmdc:mga0sz30_381982_c1_266_538 90
2228 3300053087 Ga0500643_000120 Ga0500643_000120_39925_40197 90
2229 3300053103 Ga0500555_001368 Ga0500555_001368_3589_3861 90
2230 3300053108 Ga0500562_022886 Ga0500562_022886_1282_1554 90
2231 3300053160 Ga0500633_0000338 Ga0500633_0000338_3316_3588 90
2232 3300053163 Ga0500639_225152 Ga0500639_225152_217_489 90
2233 3300053730 Ga0500645_004128 Ga0500645_004128_2082_2354 90
2234 3300054114 Ga0501084_0031132 Ga0501084_0031132_2648_2920 90
2235 3300054114 Ga0501084_1842066 Ga0501084_1842066_12_293 90
2236 3300059421 Ga0590071_031895 Ga0590071_031895_782_1129 90
2237 3300059478 Ga0587093_002581 Ga0587093_002581_337_609 90
2238 3300059492 Ga0587073_0000278 Ga0587073_0000278_291_563 90
2239 3300059503 Ga0587080_000220 Ga0587080_000220_3614_3886 90
2240 3300059503 Ga0587080_028410 Ga0587080_028410_140_412 90
2241 3300059504 Ga0587082_000004 Ga0587082_000004_10889_11161 90
2242 3300059507 Ga0587086_014710 Ga0587086_014710_565_837 90
2243 3300059604 Ga0587098_021321 Ga0587098_021321_86_358 90
2244 3300059604 Ga0587098_023827 Ga0587098_023827_58_330 90
2245 3300059605 Ga0587106_000089 Ga0587106_000089_3226_3498 90
2246 3300059605 Ga0587106_070278 Ga0587106_070278_154_426 90
2247 3300059608 Ga0587129_011403 Ga0587129_011403_367_639 90
2248 3300059625 Ga0587113_009735 Ga0587113_009735_558_830 90
2249 3300059630 Ga0587128_029497 Ga0587128_029497_38_310 90
2250 3300059640 Ga0587067_000324 Ga0587067_000324_98_370 90
2251 3300059640 Ga0587067_000398 Ga0587067_000398_418_690 90
2252 3300059642 Ga0587069_100053 Ga0587069_100053_147_419 90
2253 3300059643 Ga0587072_002394 Ga0587072_002394_2027_2299 90
2254 3300059643 Ga0587072_036139 Ga0587072_036139_566_838 90
2255 3300059644 Ga0587075_021051 Ga0587075_021051_551_823 90
2256 3300059645 Ga0587076_009931 Ga0587076_009931_147_419 90
2257 3300059646 Ga0587078_004788 Ga0587078_004788_314_586 90
2258 3300059646 Ga0587078_015465 Ga0587078_015465_118_390 90
2259 3300059646 Ga0587078_017510 Ga0587078_017510_482_754 90
2260 3300059652 Ga0587107_013340 Ga0587107_013340_188_460 90
2261 3300059655 Ga0587114_132590 Ga0587114_132590_32_304 90
2262 3300060344 Ga0587071_016267 Ga0587071_016267_998_1270 90
2263 3300060344 Ga0587071_052920 Ga0587071_052920_126_398 90
2264 3300060344 Ga0587071_102579 Ga0587071_102579_270_542 90
2265 3300060344 Ga0587071_112273 Ga0587071_112273_94_366 90
2266 3300060344 Ga0587071_133884 Ga0587071_133884_65_337 90
2267 3300060344 Ga0587071_210935 Ga0587071_210935_94_366 90
2268 3300060353 Ga0501082_0155579 Ga0501082_0155579_86_358 90
2269 3300061719 Ga0466962_0007521 Ga0466962_0007521_639_911 90
2270 3300061719 Ga0466962_0088906 Ga0466962_0088906_467_739 90
2271 3300061719 Ga0466962_0115984 Ga0466962_0115984_159_431 90
2272 3300061719 Ga0466962_0215049 Ga0466962_0215049_43_315 90
2273 2124908027 MRS2a_Contig_30 MRS2a_00199290 91
2274 2162886007 SwRhRL2b_contig_1172913 SwRhRL2b_0200.00007200 91
2275 2162886007 SwRhRL2b_contig_1776613 SwRhRL2b_0831.00001020 91
2276 3300001904 JGI24736J21556_1009926 JGI24736J21556_10099263 91
2277 3300001915 JGI24741J21665_1004452 JGI24741J21665_10044524 91
2278 3300001915 JGI24741J21665_1006431 JGI24741J21665_10064312 91
2279 3300001915 JGI24741J21665_1010023 JGI24741J21665_10100232 91
2280 3300001915 JGI24741J21665_1018609 JGI24741J21665_10186091 91
2281 3300001915 JGI24741J21665_1040660 JGI24741J21665_10406602 91
2282 3300001977 JGI24746J21847_1019566 JGI24746J21847_10195662 91
2283 3300001979 JGI24740J21852_10001224 JGI24740J21852_1000122415 91
2284 3300001979 JGI24740J21852_10003737 JGI24740J21852_100037379 91
2285 3300001979 JGI24740J21852_10007528 JGI24740J21852_100075288 91
2286 3300001979 JGI24740J21852_10012232 JGI24740J21852_100122326 91
2287 3300001979 JGI24740J21852_10146508 JGI24740J21852_101465082 91
2288 3300001989 JGI24739J22299_10062669 JGI24739J22299_100626692 91
2289 3300002704 JGI25155J39150_1000031 JGI25155J39150_10000316 91
2290 3300002705 JGI25156J39149_1000040 JGI25156J39149_1000040111 91
2291 3300002705 JGI25156J39149_1031613 JGI25156J39149_10316131 91
2292 3300002738 JGI25154J39366_1000060 JGI25154J39366_10000607 91
2293 3300002738 JGI25154J39366_1002089 JGI25154J39366_10020893 91
2294 3300002739 JGI25158J39367_1015001 JGI25158J39367_10150012 91
2295 3300002739 JGI25158J39367_1023694 JGI25158J39367_10236942 91
2296 3300002741 JGI25157J39369_1000058 JGI25157J39369_10000587 91
2297 3300002771 JGI25163J39215_1001875 JGI25163J39215_10018755 91
2298 3300002773 JGI25152J39213_1010210 JGI25152J39213_10102102 91
2299 3300002773 JGI25152J39213_1018186 JGI25152J39213_10181863 91
2300 3300002774 JGI25150J39212_1013182 JGI25150J39212_10131823 91
2301 3300002987 JGI25159J45721_1006612 JGI25159J45721_10066127 91
2302 3300002987 JGI25159J45721_1032032 JGI25159J45721_10320322 91
2303 3300003163 Ga0006759J45824_1029280 Ga0006759J45824_10292802 91
2304 3300003163 Ga0006759J45824_1069561 Ga0006759J45824_10695612 91
2305 3300003187 JGI25151J46595_10007660 JGI25151J46595_100076608 91
2306 3300003187 JGI25151J46595_10036692 JGI25151J46595_100366923 91
2307 3300003215 JGI25153J46596_10019972 JGI25153J46596_100199722 91
2308 3300003215 JGI25153J46596_10062262 JGI25153J46596_100622622 91
2309 3300003300 Ga0006758J48902_1014812 Ga0006758J48902_10148122 91
2310 3300003300 Ga0006758J48902_1015573 Ga0006758J48902_10155731 91
2311 3300003308 Ga0006777J48905_1024353 Ga0006777J48905_10243532 91
2312 3300003323 rootH1_10017276 rootH1_100172762 91
2313 3300003323 rootH1_10060094 rootH1_100600947 91
2314 3300003354 JGI25160J50197_1006136 JGI25160J50197_10061365 91
2315 3300003354 JGI25160J50197_1087302 JGI25160J50197_10873021 91
2316 3300003374 JGI25161J50226_1000021 JGI25161J50226_1000021168 91
2317 3300003374 JGI25161J50226_1013861 JGI25161J50226_10138612 91
2318 3300003382 JGI26139J50223_101177 JGI26139J50223_1011771 91
2319 3300003383 JGI26140J50224_103888 JGI26140J50224_1038881 91
2320 3300003405 JGI26132J50249_101728 JGI26132J50249_1017282 91
2321 3300003504 JGI26138J51218_100502 JGI26138J51218_1005022 91
2322 3300003544 Ga0007417J51691_1021462 Ga0007417J51691_10214622 91
2323 3300003559 Ga0007427J51700_102388 Ga0007427J51700_1023884 91
2324 3300003559 Ga0007427J51700_117842 Ga0007427J51700_1178422 91
2325 3300003568 Ga0006781J51513_1037588 Ga0006781J51513_10375882 91
2326 3300003574 Ga0007410J51695_1018423 Ga0007410J51695_10184232 91
2327 3300003574 Ga0007410J51695_1018957 Ga0007410J51695_10189572 91
2328 3300003574 Ga0007410J51695_1019754 Ga0007410J51695_10197546 91
2329 3300003574 Ga0007410J51695_1063545 Ga0007410J51695_10635452 91
2330 3300003574 Ga0007410J51695_1074802 Ga0007410J51695_10748022 91
2331 3300003575 Ga0007409J51694_1018377 Ga0007409J51694_10183776 91
2332 3300003575 Ga0007409J51694_1057489 Ga0007409J51694_10574892 91
2333 3300003577 Ga0007416J51690_1019168 Ga0007416J51690_10191682 91
2334 3300003577 Ga0007416J51690_1029297 Ga0007416J51690_10292974 91
2335 3300003577 Ga0007416J51690_1048204 Ga0007416J51690_10482042 91
2336 3300003577 Ga0007416J51690_1075250 Ga0007416J51690_10752502 91
2337 3300003578 Ga0006562J51391_1032739 Ga0006562J51391_10327393 91
2338 3300003579 Ga0007429J51699_1042349 Ga0007429J51699_10423492 91
2339 3300003579 Ga0007429J51699_1052955 Ga0007429J51699_10529551 91
2340 3300003579 Ga0007429J51699_1059725 Ga0007429J51699_10597251 91
2341 3300003693 Ga0032354_1037710 Ga0032354_10377105 91
2342 3300003693 Ga0032354_1041331 Ga0032354_10413314 91
2343 3300003693 Ga0032354_1093160 Ga0032354_10931601 91
2344 3300003735 Ga0006780_1028552 Ga0006780_10285522 91
2345 3300003735 Ga0006780_1029635 Ga0006780_10296352 91
2346 3300003751 Ga0055538_1000042 Ga0055538_1000042151 91
2347 3300003752 Ga0055539_1000055 Ga0055539_1000055151 91
2348 3300003756 Ga0055533_1000067 Ga0055533_1000067151 91
2349 3300003758 Ga0055532_1000053 Ga0055532_1000053151 91
2350 3300003760 Ga0055527_1008251 Ga0055527_10082511 91
2351 3300003761 Ga0055535_1000833 Ga0055535_10008339 91
2352 3300003761 Ga0055535_1002233 Ga0055535_10022336 91
2353 3300003762 Ga0055542_1000811 Ga0055542_10008118 91
2354 3300003771 Ga0055526_1061500 Ga0055526_10615001 91
2355 3300003771 Ga0055526_1096816 Ga0055526_10968161 91
2356 3300003771 Ga0055526_1096935 Ga0055526_10969351 91
2357 3300003773 Ga0055537_1021185 Ga0055537_10211852 91
2358 3300003773 Ga0055537_1024756 Ga0055537_10247561 91
2359 3300003773 Ga0055537_1028635 Ga0055537_10286351 91
2360 3300003773 Ga0055537_1029032 Ga0055537_10290321 91
2361 3300003775 Ga0055524_1000338 Ga0055524_10003386 91
2362 3300003775 Ga0055524_1084035 Ga0055524_10840351 91
2363 3300003781 Ga0055536_1021046 Ga0055536_10210463 91
2364 3300003784 Ga0055534_1010567 Ga0055534_10105674 91
2365 3300003784 Ga0055534_1024681 Ga0055534_10246811 91
2366 3300003784 Ga0055534_1036544 Ga0055534_10365441 91
2367 3300003784 Ga0055534_1036622 Ga0055534_10366221 91
2368 3300003790 Ga0055528_1001693 Ga0055528_10016935 91
2369 3300003790 Ga0055528_1024938 Ga0055528_10249383 91
2370 3300003791 Ga0055530_10009756 Ga0055530_100097565 91
2371 3300003791 Ga0055530_10013347 Ga0055530_100133472 91
2372 3300003791 Ga0055530_10024936 Ga0055530_100249362 91
2373 3300003792 Ga0055540_1000274 Ga0055540_100027455 91
2374 3300003792 Ga0055540_1015562 Ga0055540_10155621 91
2375 3300003794 Ga0055531_10003374 Ga0055531_100033745 91
2376 3300003794 Ga0055531_10025809 Ga0055531_100258094 91
2377 3300003794 Ga0055531_10081564 Ga0055531_100815642 91
2378 3300003841 Ga0055541_1000042 Ga0055541_100004226 91
2379 3300003856 Ga0058692_1010052 Ga0058692_10100522 91
2380 3300003856 Ga0058692_1022959 Ga0058692_10229592 91
2381 3300003856 Ga0058692_1028438 Ga0058692_10284382 91
2382 3300004625 Ga0055543_1000238 Ga0055543_100023848 91
2383 3300004785 Ga0058858_1003843 Ga0058858_10038432 91
2384 3300004785 Ga0058858_1016017 Ga0058858_10160173 91
2385 3300004785 Ga0058858_1422938 Ga0058858_14229383 91
2386 3300004798 Ga0058859_11780553 Ga0058859_117805533 91
2387 3300004798 Ga0058859_11828919 Ga0058859_118289191 91
2388 3300004799 Ga0058863_10015881 Ga0058863_100158815 91
2389 3300004799 Ga0058863_11705057 Ga0058863_117050572 91
2390 3300004800 Ga0058861_12043031 Ga0058861_120430312 91
2391 3300004800 Ga0058861_12044230 Ga0058861_120442303 91
2392 3300004801 Ga0058860_10012449 Ga0058860_100124491 91
2393 3300004801 Ga0058860_10027358 Ga0058860_100273582 91
2394 3300004801 Ga0058860_10056819 Ga0058860_100568192 91
2395 3300004801 Ga0058860_10099424 Ga0058860_100994243 91
2396 3300004801 Ga0058860_10224633 Ga0058860_102246331 91
2397 3300004803 Ga0058862_10010531 Ga0058862_100105312 91
2398 3300004803 Ga0058862_12536277 Ga0058862_125362772 91
2399 3300005262 Ga0065165_1026628 Ga0065165_10266282 91
2400 3300005262 Ga0065165_1039064 Ga0065165_10390641 91
2401 3300005288 Ga0065714_10000007 Ga0065714_100000077 91
2402 3300005288 Ga0065714_10012529 Ga0065714_100125293 91
2403 3300005288 Ga0065714_10012673 Ga0065714_100126733 91
2404 3300005288 Ga0065714_10028497 Ga0065714_100284972 91
2405 3300005288 Ga0065714_10148435 Ga0065714_101484351 91
2406 3300005288 Ga0065714_10408433 Ga0065714_104084331 91
2407 3300005289 Ga0065704_10020815 Ga0065704_100208153 91
2408 3300005289 Ga0065704_10141096 Ga0065704_101410962 91
2409 3300005289 Ga0065704_10145820 Ga0065704_101458202 91
2410 3300005289 Ga0065704_10217134 Ga0065704_102171341 91
2411 3300005289 Ga0065704_10630414 Ga0065704_106304141 91
2412 3300005290 Ga0065712_10034257 Ga0065712_100342572 91
2413 3300005290 Ga0065712_10708596 Ga0065712_107085961 91
2414 3300005290 Ga0065712_10840486 Ga0065712_108404861 91
2415 3300005293 Ga0065715_10009176 Ga0065715_100091762 91
2416 3300005293 Ga0065715_11117656 Ga0065715_111176561 91
2417 3300005327 Ga0070658_10367216 Ga0070658_103672162 91
2418 3300005327 Ga0070658_10600713 Ga0070658_106007131 91
2419 3300005327 Ga0070658_10966965 Ga0070658_109669651 91
2420 3300005327 Ga0070658_11402470 Ga0070658_114024701 91
2421 3300005328 Ga0070676_10152962 Ga0070676_101529623 91
2422 3300005329 Ga0070683_100111715 Ga0070683_1001117155 91
2423 3300005329 Ga0070683_100579184 Ga0070683_1005791842 91
2424 3300005329 Ga0070683_100748167 Ga0070683_1007481672 91
2425 3300005329 Ga0070683_102155092 Ga0070683_1021550921 91
2426 3300005330 Ga0070690_100385444 Ga0070690_1003854441 91
2427 3300005331 Ga0070670_100303660 Ga0070670_1003036603 91
2428 3300005331 Ga0070670_100505876 Ga0070670_1005058762 91
2429 3300005331 Ga0070670_100575042 Ga0070670_1005750422 91
2430 3300005331 Ga0070670_100974355 Ga0070670_1009743552 91
2431 3300005333 Ga0070677_10051748 Ga0070677_100517484 91
2432 3300005334 Ga0068869_100131341 Ga0068869_1001313413 91
2433 3300005334 Ga0068869_100319169 Ga0068869_1003191693 91
2434 3300005334 Ga0068869_101215861 Ga0068869_1012158612 91
2435 3300005335 Ga0070666_10312836 Ga0070666_103128362 91
2436 3300005335 Ga0070666_10343832 Ga0070666_103438322 91
2437 3300005335 Ga0070666_11082769 Ga0070666_110827692 91
2438 3300005336 Ga0070680_100176719 Ga0070680_1001767193 91
2439 3300005336 Ga0070680_100194325 Ga0070680_1001943252 91
2440 3300005336 Ga0070680_100219574 Ga0070680_1002195742 91
2441 3300005336 Ga0070680_100245821 Ga0070680_1002458212 91
2442 3300005336 Ga0070680_100313899 Ga0070680_1003138992 91
2443 3300005337 Ga0070682_100005710 Ga0070682_10000571017 91
2444 3300005337 Ga0070682_100963432 Ga0070682_1009634322 91
2445 3300005337 Ga0070682_101117769 Ga0070682_1011177692 91
2446 3300005337 Ga0070682_101264338 Ga0070682_1012643381 91
2447 3300005338 Ga0068868_100033369 Ga0068868_1000333694 91
2448 3300005338 Ga0068868_100671308 Ga0068868_1006713082 91
2449 3300005338 Ga0068868_100887173 Ga0068868_1008871732 91
2450 3300005339 Ga0070660_100196258 Ga0070660_1001962582 91
2451 3300005339 Ga0070660_100214434 Ga0070660_1002144342 91
2452 3300005339 Ga0070660_100296754 Ga0070660_1002967542 91
2453 3300005339 Ga0070660_100431541 Ga0070660_1004315411 91
2454 3300005339 Ga0070660_100527256 Ga0070660_1005272562 91
2455 3300005339 Ga0070660_100563269 Ga0070660_1005632692 91
2456 3300005341 Ga0070691_10082368 Ga0070691_100823682 91
2457 3300005341 Ga0070691_10124922 Ga0070691_101249221 91
2458 3300005343 Ga0070687_100319995 Ga0070687_1003199951 91
2459 3300005344 Ga0070661_100005189 Ga0070661_1000051892 91
2460 3300005344 Ga0070661_100060170 Ga0070661_1000601705 91
2461 3300005344 Ga0070661_100063908 Ga0070661_1000639084 91
2462 3300005344 Ga0070661_100240662 Ga0070661_1002406622 91
2463 3300005344 Ga0070661_100268996 Ga0070661_1002689961 91
2464 3300005344 Ga0070661_100511161 Ga0070661_1005111611 91
2465 3300005344 Ga0070661_100563964 Ga0070661_1005639641 91
2466 3300005344 Ga0070661_101483417 Ga0070661_1014834171 91
2467 3300005345 Ga0070692_10007700 Ga0070692_100077004 91
2468 3300005345 Ga0070692_10033906 Ga0070692_100339062 91
2469 3300005347 Ga0070668_100106043 Ga0070668_1001060432 91
2470 3300005347 Ga0070668_100160966 Ga0070668_1001609664 91
2471 3300005347 Ga0070668_100292158 Ga0070668_1002921582 91
2472 3300005353 Ga0070669_100004975 Ga0070669_1000049751 91
2473 3300005353 Ga0070669_100192029 Ga0070669_1001920293 91
2474 3300005353 Ga0070669_100419198 Ga0070669_1004191982 91
2475 3300005353 Ga0070669_100698189 Ga0070669_1006981892 91
2476 3300005353 Ga0070669_101264327 Ga0070669_1012643272 91
2477 3300005354 Ga0070675_100154524 Ga0070675_1001545243 91
2478 3300005354 Ga0070675_100541104 Ga0070675_1005411041 91
2479 3300005355 Ga0070671_100183827 Ga0070671_1001838273 91
2480 3300005355 Ga0070671_101112665 Ga0070671_1011126652 91
2481 3300005355 Ga0070671_101357139 Ga0070671_1013571392 91
2482 3300005355 Ga0070671_101605198 Ga0070671_1016051981 91
2483 3300005356 Ga0070674_100092385 Ga0070674_1000923854 91
2484 3300005356 Ga0070674_100261513 Ga0070674_1002615132 91
2485 3300005356 Ga0070674_100938877 Ga0070674_1009388772 91
2486 3300005364 Ga0070673_100413930 Ga0070673_1004139303 91
2487 3300005364 Ga0070673_101105209 Ga0070673_1011052092 91
2488 3300005364 Ga0070673_101482337 Ga0070673_1014823372 91
2489 3300005365 Ga0070688_100115758 Ga0070688_1001157581 91
2490 3300005365 Ga0070688_100895485 Ga0070688_1008954852 91
2491 3300005366 Ga0070659_100082555 Ga0070659_1000825552 91
2492 3300005366 Ga0070659_100087709 Ga0070659_1000877092 91
2493 3300005366 Ga0070659_100118562 Ga0070659_1001185624 91
2494 3300005366 Ga0070659_101413658 Ga0070659_1014136582 91
2495 3300005367 Ga0070667_100030004 Ga0070667_1000300043 91
2496 3300005367 Ga0070667_100092898 Ga0070667_1000928982 91
2497 3300005367 Ga0070667_100123563 Ga0070667_1001235633 91
2498 3300005367 Ga0070667_100135527 Ga0070667_1001355272 91
2499 3300005367 Ga0070667_100220389 Ga0070667_1002203892 91
2500 3300005436 Ga0070713_100295588 Ga0070713_1002955883 91
2501 3300005437 Ga0070710_10139871 Ga0070710_101398712 91
2502 3300005438 Ga0070701_10805723 Ga0070701_108057232 91
2503 3300005440 Ga0070705_100787798 Ga0070705_1007877981 91
2504 3300005441 Ga0070700_100411194 Ga0070700_1004111941 91
2505 3300005444 Ga0070694_101362711 Ga0070694_1013627112 91
2506 3300005445 Ga0070708_100882660 Ga0070708_1008826602 91
2507 3300005455 Ga0070663_100005120 Ga0070663_10000512017 91
2508 3300005455 Ga0070663_100036599 Ga0070663_1000365996 91
2509 3300005455 Ga0070663_100070482 Ga0070663_1000704824 91
2510 3300005455 Ga0070663_100079408 Ga0070663_1000794084 91
2511 3300005455 Ga0070663_100120095 Ga0070663_1001200954 91
2512 3300005455 Ga0070663_100440482 Ga0070663_1004404822 91
2513 3300005455 Ga0070663_100481614 Ga0070663_1004816142 91
2514 3300005455 Ga0070663_100496719 Ga0070663_1004967191 91
2515 3300005455 Ga0070663_100678757 Ga0070663_1006787572 91
2516 3300005456 Ga0070678_100204118 Ga0070678_1002041182 91
2517 3300005456 Ga0070678_100362980 Ga0070678_1003629802 91
2518 3300005456 Ga0070678_100413100 Ga0070678_1004131002 91
2519 3300005456 Ga0070678_100456016 Ga0070678_1004560162 91
2520 3300005457 Ga0070662_100045686 Ga0070662_1000456862 91
2521 3300005457 Ga0070662_100148173 Ga0070662_1001481732 91
2522 3300005457 Ga0070662_100243398 Ga0070662_1002433983 91
2523 3300005457 Ga0070662_100404195 Ga0070662_1004041951 91
2524 3300005457 Ga0070662_101313803 Ga0070662_1013138031 91
2525 3300005458 Ga0070681_10000250 Ga0070681_100002505 91
2526 3300005458 Ga0070681_10072551 Ga0070681_100725512 91
2527 3300005458 Ga0070681_10247300 Ga0070681_102473002 91
2528 3300005458 Ga0070681_10555001 Ga0070681_105550013 91
2529 3300005458 Ga0070681_10784766 Ga0070681_107847662 91
2530 3300005458 Ga0070681_11558922 Ga0070681_115589222 91
2531 3300005459 Ga0068867_100121217 Ga0068867_1001212172 91
2532 3300005466 Ga0070685_10743457 Ga0070685_107434572 91
2533 3300005467 Ga0070706_100225104 Ga0070706_1002251042 91
2534 3300005467 Ga0070706_100319949 Ga0070706_1003199492 91
2535 3300005468 Ga0070707_100083981 Ga0070707_1000839812 91
2536 3300005530 Ga0070679_100258581 Ga0070679_1002585812 91
2537 3300005530 Ga0070679_101051480 Ga0070679_1010514802 91
2538 3300005530 Ga0070679_101408186 Ga0070679_1014081862 91
2539 3300005535 Ga0070684_100046485 Ga0070684_1000464855 91
2540 3300005535 Ga0070684_100592471 Ga0070684_1005924713 91
2541 3300005539 Ga0068853_100001115 Ga0068853_10000111512 91
2542 3300005539 Ga0068853_100010321 Ga0068853_1000103217 91
2543 3300005539 Ga0068853_100029334 Ga0068853_1000293343 91
2544 3300005539 Ga0068853_100126368 Ga0068853_1001263682 91
2545 3300005539 Ga0068853_100248836 Ga0068853_1002488363 91
2546 3300005539 Ga0068853_100325099 Ga0068853_1003250991 91
2547 3300005539 Ga0068853_100399949 Ga0068853_1003999492 91
2548 3300005539 Ga0068853_100434858 Ga0068853_1004348583 91
2549 3300005539 Ga0068853_100438748 Ga0068853_1004387482 91
2550 3300005539 Ga0068853_100443992 Ga0068853_1004439923 91
2551 3300005539 Ga0068853_102357326 Ga0068853_1023573261 91
2552 3300005543 Ga0070672_101619507 Ga0070672_1016195072 91
2553 3300005546 Ga0070696_100051544 Ga0070696_1000515443 91
2554 3300005546 Ga0070696_100143568 Ga0070696_1001435681 91
2555 3300005547 Ga0070693_100013884 Ga0070693_1000138849 91
2556 3300005547 Ga0070693_100025578 Ga0070693_1000255785 91
2557 3300005547 Ga0070693_100114604 Ga0070693_1001146042 91
2558 3300005547 Ga0070693_100330259 Ga0070693_1003302593 91
2559 3300005548 Ga0070665_100009996 Ga0070665_1000099962 91
2560 3300005548 Ga0070665_100114446 Ga0070665_1001144463 91
2561 3300005548 Ga0070665_100300035 Ga0070665_1003000352 91
2562 3300005548 Ga0070665_100659216 Ga0070665_1006592162 91
2563 3300005548 Ga0070665_100904094 Ga0070665_1009040942 91
2564 3300005548 Ga0070665_101232954 Ga0070665_1012329541 91
2565 3300005548 Ga0070665_102409324 Ga0070665_1024093242 91
2566 3300005549 Ga0070704_101791752 Ga0070704_1017917521 91
2567 3300005563 Ga0068855_100002511 Ga0068855_10000251130 91
2568 3300005563 Ga0068855_100111964 Ga0068855_1001119642 91
2569 3300005563 Ga0068855_100132917 Ga0068855_1001329174 91
2570 3300005563 Ga0068855_100233589 Ga0068855_1002335893 91
2571 3300005563 Ga0068855_100399501 Ga0068855_1003995012 91
2572 3300005563 Ga0068855_100467381 Ga0068855_1004673812 91
2573 3300005563 Ga0068855_100468040 Ga0068855_1004680402 91
2574 3300005563 Ga0068855_101061271 Ga0068855_1010612713 91
2575 3300005563 Ga0068855_101892356 Ga0068855_1018923562 91
2576 3300005563 Ga0068855_102405748 Ga0068855_1024057482 91
2577 3300005563 Ga0068855_102588898 Ga0068855_1025888981 91
2578 3300005564 Ga0070664_100094125 Ga0070664_1000941253 91
2579 3300005564 Ga0070664_100186680 Ga0070664_1001866804 91
2580 3300005564 Ga0070664_100200796 Ga0070664_1002007962 91
2581 3300005564 Ga0070664_100349593 Ga0070664_1003495932 91
2582 3300005564 Ga0070664_101237792 Ga0070664_1012377922 91
2583 3300005564 Ga0070664_102238629 Ga0070664_1022386292 91
2584 3300005564 Ga0070664_102350366 Ga0070664_1023503662 91
2585 3300005577 Ga0068857_100088619 Ga0068857_1000886193 91
2586 3300005577 Ga0068857_100113303 Ga0068857_1001133034 91
2587 3300005577 Ga0068857_100302868 Ga0068857_1003028682 91
2588 3300005577 Ga0068857_100356915 Ga0068857_1003569152 91
2589 3300005577 Ga0068857_100474801 Ga0068857_1004748013 91
2590 3300005577 Ga0068857_100859228 Ga0068857_1008592281 91
2591 3300005577 Ga0068857_100964727 Ga0068857_1009647272 91
2592 3300005577 Ga0068857_102328025 Ga0068857_1023280252 91
2593 3300005578 Ga0068854_100001181 Ga0068854_1000011815 91
2594 3300005578 Ga0068854_100062722 Ga0068854_1000627223 91
2595 3300005578 Ga0068854_100162608 Ga0068854_1001626084 91
2596 3300005578 Ga0068854_100270148 Ga0068854_1002701482 91
2597 3300005578 Ga0068854_100871411 Ga0068854_1008714111 91
2598 3300005614 Ga0068856_100052710 Ga0068856_1000527107 91
2599 3300005614 Ga0068856_100106606 Ga0068856_1001066065 91
2600 3300005614 Ga0068856_100111271 Ga0068856_1001112712 91
2601 3300005614 Ga0068856_100111931 Ga0068856_1001119311 91
2602 3300005614 Ga0068856_100149200 Ga0068856_1001492003 91
2603 3300005614 Ga0068856_100204651 Ga0068856_1002046514 91
2604 3300005616 Ga0068852_100031217 Ga0068852_1000312173 91
2605 3300005616 Ga0068852_100156669 Ga0068852_1001566691 91
2606 3300005616 Ga0068852_100237376 Ga0068852_1002373763 91
2607 3300005616 Ga0068852_100261322 Ga0068852_1002613222 91
2608 3300005616 Ga0068852_100319945 Ga0068852_1003199452 91
2609 3300005616 Ga0068852_100530590 Ga0068852_1005305902 91
2610 3300005616 Ga0068852_100673130 Ga0068852_1006731302 91
2611 3300005616 Ga0068852_101534194 Ga0068852_1015341941 91
2612 3300005617 Ga0068859_102558224 Ga0068859_1025582242 91
2613 3300005618 Ga0068864_100185391 Ga0068864_1001853913 91
2614 3300005618 Ga0068864_100535237 Ga0068864_1005352373 91
2615 3300005719 Ga0068861_100118072 Ga0068861_1001180722 91
2616 3300005719 Ga0068861_101554380 Ga0068861_1015543802 91
2617 3300005834 Ga0068851_10000002 Ga0068851_1000000214 91
2618 3300005834 Ga0068851_10014017 Ga0068851_100140173 91
2619 3300005834 Ga0068851_10026539 Ga0068851_100265392 91
2620 3300005834 Ga0068851_10027292 Ga0068851_100272924 91
2621 3300005834 Ga0068851_10175429 Ga0068851_101754293 91
2622 3300005840 Ga0068870_10173464 Ga0068870_101734643 91
2623 3300005841 Ga0068863_100115629 Ga0068863_1001156292 91
2624 3300005841 Ga0068863_100530091 Ga0068863_1005300912 91
2625 3300005841 Ga0068863_100764277 Ga0068863_1007642771 91
2626 3300005841 Ga0068863_102529846 Ga0068863_1025298462 91
2627 3300005842 Ga0068858_100334092 Ga0068858_1003340922 91
2628 3300005842 Ga0068858_100579150 Ga0068858_1005791502 91
2629 3300005843 Ga0068860_100331590 Ga0068860_1003315902 91
2630 3300005843 Ga0068860_100504897 Ga0068860_1005048972 91
2631 3300005844 Ga0068862_100088990 Ga0068862_1000889902 91
2632 3300005844 Ga0068862_100606903 Ga0068862_1006069032 91
2633 3300005937 Ga0081455_10053310 Ga0081455_100533106 91
2634 3300006028 Ga0070717_10573168 Ga0070717_105731682 91
2635 3300006038 Ga0075365_10052184 Ga0075365_100521843 91
2636 3300006038 Ga0075365_10058118 Ga0075365_100581185 91
2637 3300006038 Ga0075365_10163444 Ga0075365_101634442 91
2638 3300006038 Ga0075365_10253119 Ga0075365_102531193 91
2639 3300006042 Ga0075368_10027366 Ga0075368_100273662 91
2640 3300006042 Ga0075368_10222799 Ga0075368_102227991 91
2641 3300006042 Ga0075368_10272919 Ga0075368_102729192 91
2642 3300006042 Ga0075368_10289824 Ga0075368_102898241 91
2643 3300006042 Ga0075368_10375626 Ga0075368_103756262 91
2644 3300006042 Ga0075368_10467209 Ga0075368_104672092 91
2645 3300006048 Ga0075363_100100355 Ga0075363_1001003552 91
2646 3300006048 Ga0075363_100186638 Ga0075363_1001866382 91
2647 3300006048 Ga0075363_100231239 Ga0075363_1002312392 91
2648 3300006051 Ga0075364_10020655 Ga0075364_100206553 91
2649 3300006051 Ga0075364_10036778 Ga0075364_100367786 91
2650 3300006051 Ga0075364_10140428 Ga0075364_101404283 91
2651 3300006058 Ga0075432_10012579 Ga0075432_100125792 91
2652 3300006058 Ga0075432_10068576 Ga0075432_100685762 91
2653 3300006058 Ga0075432_10087503 Ga0075432_100875032 91
2654 3300006163 Ga0070715_10440053 Ga0070715_104400532 91
2655 3300006173 Ga0070716_101150851 Ga0070716_1011508512 91
2656 3300006177 Ga0075362_10276881 Ga0075362_102768812 91
2657 3300006177 Ga0075362_10294513 Ga0075362_102945132 91
2658 3300006177 Ga0075362_10645431 Ga0075362_106454312 91
2659 3300006177 Ga0075362_10683527 Ga0075362_106835271 91
2660 3300006178 Ga0075367_10084014 Ga0075367_100840142 91
2661 3300006178 Ga0075367_10264668 Ga0075367_102646682 91
2662 3300006178 Ga0075367_10302737 Ga0075367_103027372 91
2663 3300006178 Ga0075367_10360780 Ga0075367_103607801 91
2664 3300006178 Ga0075367_10905274 Ga0075367_109052741 91
2665 3300006186 Ga0075369_10093292 Ga0075369_100932922 91
2666 3300006186 Ga0075369_10136829 Ga0075369_101368292 91
2667 3300006186 Ga0075369_10305635 Ga0075369_103056352 91
2668 3300006194 Ga0075427_10034804 Ga0075427_100348042 91
2669 3300006195 Ga0075366_10034671 Ga0075366_100346713 91
2670 3300006195 Ga0075366_10085266 Ga0075366_100852661 91
2671 3300006195 Ga0075366_10264664 Ga0075366_102646643 91
2672 3300006195 Ga0075366_10284638 Ga0075366_102846382 91
2673 3300006195 Ga0075366_10315364 Ga0075366_103153643 91
2674 3300006237 Ga0097621_100184626 Ga0097621_1001846263 91
2675 3300006237 Ga0097621_100238448 Ga0097621_1002384483 91
2676 3300006237 Ga0097621_100291714 Ga0097621_1002917142 91
2677 3300006237 Ga0097621_100838472 Ga0097621_1008384722 91
2678 3300006237 Ga0097621_101246759 Ga0097621_1012467592 91
2679 3300006353 Ga0075370_10058479 Ga0075370_100584794 91
2680 3300006353 Ga0075370_10078175 Ga0075370_100781754 91
2681 3300006353 Ga0075370_10140959 Ga0075370_101409593 91
2682 3300006353 Ga0075370_10144759 Ga0075370_101447592 91
2683 3300006353 Ga0075370_10153606 Ga0075370_101536062 91
2684 3300006353 Ga0075370_10325798 Ga0075370_103257983 91
2685 3300006358 Ga0068871_100228799 Ga0068871_1002287992 91
2686 3300006358 Ga0068871_100393180 Ga0068871_1003931803 91
2687 3300006358 Ga0068871_100659861 Ga0068871_1006598612 91
2688 3300006881 Ga0068865_100071838 Ga0068865_1000718385 91
2689 3300006914 Ga0075436_100178041 Ga0075436_1001780413 91
2690 3300006914 Ga0075436_100724719 Ga0075436_1007247192 91
2691 3300006931 Ga0097620_102558128 Ga0097620_1025581282 91
2692 3300006944 Ga0099823_1024919 Ga0099823_10249196 91
2693 3300006946 Ga0079104_1005406 Ga0079104_10054069 91
2694 3300006946 Ga0079104_1032881 Ga0079104_10328813 91
2695 3300006948 Ga0099826_10036954 Ga0099826_100369541 91
2696 3300006948 Ga0099826_10059291 Ga0099826_100592916 91
2697 3300009011 Ga0105251_10003171 Ga0105251_100031712 91
2698 3300009036 Ga0105244_10051039 Ga0105244_100510392 91
2699 3300009036 Ga0105244_10072659 Ga0105244_100726592 91
2700 3300009036 Ga0105244_10384474 Ga0105244_103844742 91
2701 3300009093 Ga0105240_10001149 Ga0105240_1000114926 91
2702 3300009093 Ga0105240_10058398 Ga0105240_100583987 91
2703 3300009093 Ga0105240_10113841 Ga0105240_101138412 91
2704 3300009093 Ga0105240_10157226 Ga0105240_101572264 91
2705 3300009093 Ga0105240_10159725 Ga0105240_101597255 91
2706 3300009093 Ga0105240_10274006 Ga0105240_102740062 91
2707 3300009093 Ga0105240_10391938 Ga0105240_103919383 91
2708 3300009093 Ga0105240_10829768 Ga0105240_108297682 91
2709 3300009093 Ga0105240_11268861 Ga0105240_112688611 91
2710 3300009093 Ga0105240_11478161 Ga0105240_114781612 91
2711 3300009093 Ga0105240_11608021 Ga0105240_116080212 91
2712 3300009094 Ga0111539_10989556 Ga0111539_109895562 91
2713 3300009098 Ga0105245_10080216 Ga0105245_100802163 91
2714 3300009098 Ga0105245_10090047 Ga0105245_100900474 91
2715 3300009098 Ga0105245_10207953 Ga0105245_102079532 91
2716 3300009098 Ga0105245_11431938 Ga0105245_114319382 91
2717 3300009098 Ga0105245_11877468 Ga0105245_118774682 91
2718 3300009101 Ga0105247_10318646 Ga0105247_103186462 91
2719 3300009101 Ga0105247_11470220 Ga0105247_114702201 91
2720 3300009148 Ga0105243_10205661 Ga0105243_102056611 91
2721 3300009148 Ga0105243_10756434 Ga0105243_107564343 91
2722 3300009148 Ga0105243_12002865 Ga0105243_120028652 91
2723 3300009174 Ga0105241_10087830 Ga0105241_100878302 91
2724 3300009174 Ga0105241_10143213 Ga0105241_101432134 91
2725 3300009174 Ga0105241_10378260 Ga0105241_103782602 91
2726 3300009174 Ga0105241_10795845 Ga0105241_107958453 91
2727 3300009176 Ga0105242_10893184 Ga0105242_108931842 91
2728 3300009176 Ga0105242_11460796 Ga0105242_114607962 91
2729 3300009176 Ga0105242_11688903 Ga0105242_116889032 91
2730 3300009176 Ga0105242_11874289 Ga0105242_118742891 91
2731 3300009177 Ga0105248_10046830 Ga0105248_100468304 91
2732 3300009177 Ga0105248_10052664 Ga0105248_100526647 91
2733 3300009177 Ga0105248_10656313 Ga0105248_106563132 91
2734 3300009177 Ga0105248_10682515 Ga0105248_106825153 91
2735 3300009177 Ga0105248_11237000 Ga0105248_112370001 91
2736 3300009545 Ga0105237_10025280 Ga0105237_100252807 91
2737 3300009545 Ga0105237_10044221 Ga0105237_100442217 91
2738 3300009545 Ga0105237_10197637 Ga0105237_101976373 91
2739 3300009545 Ga0105237_10776940 Ga0105237_107769402 91
2740 3300009545 Ga0105237_11237717 Ga0105237_112377172 91
2741 3300009551 Ga0105238_10022011 Ga0105238_100220119 91
2742 3300009551 Ga0105238_10069516 Ga0105238_100695162 91
2743 3300009551 Ga0105238_10208375 Ga0105238_102083753 91
2744 3300009551 Ga0105238_10431968 Ga0105238_104319682 91
2745 3300009551 Ga0105238_10505322 Ga0105238_105053223 91
2746 3300009553 Ga0105249_10036583 Ga0105249_100365838 91
2747 3300009553 Ga0105249_10397717 Ga0105249_103977173 91
2748 3300009553 Ga0105249_10581513 Ga0105249_105815133 91
2749 3300009553 Ga0105249_10762586 Ga0105249_107625862 91
2750 3300009553 Ga0105249_12520520 Ga0105249_125205202 91
2751 3300010375 Ga0105239_10029678 Ga0105239_100296788 91
2752 3300010375 Ga0105239_10107225 Ga0105239_101072253 91
2753 3300010375 Ga0105239_10232732 Ga0105239_102327324 91
2754 3300010375 Ga0105239_10243349 Ga0105239_102433494 91
2755 3300010375 Ga0105239_10475703 Ga0105239_104757031 91
2756 3300011119 Ga0105246_10283799 Ga0105246_102837992 91
2757 3300011119 Ga0105246_10544156 Ga0105246_105441561 91
2758 3300012478 Ga0157328_1006916 Ga0157328_10069162 91
2759 3300012480 Ga0157346_1016123 Ga0157346_10161232 91
2760 3300012495 Ga0157323_1001641 Ga0157323_10016413 91
2761 3300012497 Ga0157319_1004824 Ga0157319_10048243 91
2762 3300012497 Ga0157319_1017079 Ga0157319_10170792 91
2763 3300012498 Ga0157345_1031286 Ga0157345_10312862 91
2764 3300012505 Ga0157339_1001246 Ga0157339_10012463 91
2765 3300012506 Ga0157324_1002058 Ga0157324_10020582 91
2766 3300012507 Ga0157342_1002786 Ga0157342_10027863 91
2767 3300012512 Ga0157327_1013073 Ga0157327_10130732 91
2768 3300012513 Ga0157326_1007245 Ga0157326_10072452 91
2769 3300013100 Ga0157373_10026614 Ga0157373_100266144 91
2770 3300013100 Ga0157373_10037570 Ga0157373_100375702 91
2771 3300013100 Ga0157373_10039069 Ga0157373_100390691 91
2772 3300013100 Ga0157373_10162162 Ga0157373_101621623 91
2773 3300013100 Ga0157373_10199115 Ga0157373_101991153 91
2774 3300013100 Ga0157373_10747563 Ga0157373_107475632 91
2775 3300013102 Ga0157371_10025254 Ga0157371_1002525410 91
2776 3300013102 Ga0157371_10114710 Ga0157371_101147103 91
2777 3300013102 Ga0157371_10132466 Ga0157371_101324664 91
2778 3300013102 Ga0157371_10142030 Ga0157371_101420303 91
2779 3300013102 Ga0157371_10214782 Ga0157371_102147823 91
2780 3300013102 Ga0157371_10483637 Ga0157371_104836373 91
2781 3300013102 Ga0157371_11473246 Ga0157371_114732462 91
2782 3300013104 Ga0157370_10073111 Ga0157370_100731116 91
2783 3300013104 Ga0157370_10175248 Ga0157370_101752483 91
2784 3300013104 Ga0157370_10313849 Ga0157370_103138493 91
2785 3300013104 Ga0157370_10524185 Ga0157370_105241853 91
2786 3300013104 Ga0157370_10734321 Ga0157370_107343212 91
2787 3300013104 Ga0157370_10953303 Ga0157370_109533032 91
2788 3300013105 Ga0157369_10023079 Ga0157369_1002307910 91
2789 3300013105 Ga0157369_10029397 Ga0157369_100293978 91
2790 3300013105 Ga0157369_10127097 Ga0157369_101270974 91
2791 3300013105 Ga0157369_10456990 Ga0157369_104569901 91
2792 3300013105 Ga0157369_10480209 Ga0157369_104802092 91
2793 3300013105 Ga0157369_10502446 Ga0157369_105024462 91
2794 3300013105 Ga0157369_10898137 Ga0157369_108981371 91
2795 3300013296 Ga0157374_10130368 Ga0157374_101303682 91
2796 3300013296 Ga0157374_10245726 Ga0157374_102457264 91
2797 3300013296 Ga0157374_10565436 Ga0157374_105654362 91
2798 3300013297 Ga0157378_10131466 Ga0157378_101314663 91
2799 3300013297 Ga0157378_10976184 Ga0157378_109761842 91
2800 3300013297 Ga0157378_12285307 Ga0157378_122853072 91
2801 3300013306 Ga0163162_10281125 Ga0163162_102811253 91
2802 3300013306 Ga0163162_10983754 Ga0163162_109837543 91
2803 3300013306 Ga0163162_12764934 Ga0163162_127649342 91
2804 3300013307 Ga0157372_10030525 Ga0157372_100305254 91
2805 3300013307 Ga0157372_10045136 Ga0157372_100451367 91
2806 3300013307 Ga0157372_10076736 Ga0157372_100767369 91
2807 3300013307 Ga0157372_10082823 Ga0157372_100828237 91
2808 3300013307 Ga0157372_10148669 Ga0157372_101486694 91
2809 3300013307 Ga0157372_10273674 Ga0157372_102736741 91
2810 3300013307 Ga0157372_10592496 Ga0157372_105924962 91
2811 3300013307 Ga0157372_10674149 Ga0157372_106741493 91
2812 3300013307 Ga0157372_10834864 Ga0157372_108348642 91
2813 3300013307 Ga0157372_11664969 Ga0157372_116649692 91
2814 3300013307 Ga0157372_13473563 Ga0157372_134735631 91
2815 3300013308 Ga0157375_11312631 Ga0157375_113126311 91
2816 3300013308 Ga0157375_12950984 Ga0157375_129509842 91
2817 3300014325 Ga0163163_10525946 Ga0163163_105259462 91
2818 3300014326 Ga0157380_10749650 Ga0157380_107496502 91
2819 3300014326 Ga0157380_13474071 Ga0157380_134740711 91
2820 3300014497 Ga0182008_10137597 Ga0182008_101375971 91
2821 3300014497 Ga0182008_10193644 Ga0182008_101936441 91
2822 3300014497 Ga0182008_10201668 Ga0182008_102016682 91
2823 3300014497 Ga0182008_10457886 Ga0182008_104578861 91
2824 3300014497 Ga0182008_10481862 Ga0182008_104818622 91
2825 3300014968 Ga0157379_10223219 Ga0157379_102232193 91
2826 3300014968 Ga0157379_10325002 Ga0157379_103250022 91
2827 3300014969 Ga0157376_10120992 Ga0157376_101209922 91
2828 3300014969 Ga0157376_10801918 Ga0157376_108019182 91
2829 3300014969 Ga0157376_11275532 Ga0157376_112755322 91
2830 3300015261 Ga0182006_1060043 Ga0182006_10600433 91
2831 3300015261 Ga0182006_1098157 Ga0182006_10981573 91
2832 3300015262 Ga0182007_10003528 Ga0182007_100035284 91
2833 3300015262 Ga0182007_10043580 Ga0182007_100435802 91
2834 3300015262 Ga0182007_10155126 Ga0182007_101551262 91
2835 3300015262 Ga0182007_10280660 Ga0182007_102806602 91
2836 3300015265 Ga0182005_1101035 Ga0182005_11010352 91
2837 3300015683 Ga0183362_10007 Ga0183362_10007235 91
2838 3300017792 Ga0163161_10230968 Ga0163161_102309682 91
2839 3300017792 Ga0163161_10412031 Ga0163161_104120313 91
2840 3300017792 Ga0163161_10786293 Ga0163161_107862932 91
2841 3300017792 Ga0163161_10942925 Ga0163161_109429252 91
2842 3300017792 Ga0163161_10994031 Ga0163161_109940312 91
2843 3300017792 Ga0163161_11113116 Ga0163161_111131161 91
2844 3300020069 Ga0197907_10107589 Ga0197907_101075894 91
2845 3300020070 Ga0206356_10069576 Ga0206356_100695766 91
2846 3300020070 Ga0206356_10382875 Ga0206356_103828752 91
2847 3300020070 Ga0206356_10444783 Ga0206356_104447832 91
2848 3300020070 Ga0206356_10446557 Ga0206356_104465572 91
2849 3300020070 Ga0206356_11731388 Ga0206356_117313882 91
2850 3300020075 Ga0206349_1449394 Ga0206349_14493942 91
2851 3300020076 Ga0206355_1392352 Ga0206355_13923522 91
2852 3300020077 Ga0206351_10137113 Ga0206351_101371132 91
2853 3300020077 Ga0206351_10247550 Ga0206351_102475507 91
2854 3300020078 Ga0206352_10668756 Ga0206352_106687562 91
2855 3300020078 Ga0206352_11092907 Ga0206352_110929076 91
2856 3300020080 Ga0206350_10101126 Ga0206350_101011261 91
2857 3300020080 Ga0206350_10601137 Ga0206350_106011377 91
2858 3300020081 Ga0206354_10159778 Ga0206354_101597782 91
2859 3300020082 Ga0206353_10129542 Ga0206353_1012954217 91
2860 3300020082 Ga0206353_10294942 Ga0206353_102949424 91
2861 3300020082 Ga0206353_10514404 Ga0206353_105144042 91
2862 3300020610 Ga0154015_1010654 Ga0154015_10106547 91
2863 3300020610 Ga0154015_1040205 Ga0154015_10402051 91
2864 3300020610 Ga0154015_1144278 Ga0154015_11442782 91
2865 3300022467 Ga0224712_10002283 Ga0224712_100022832 91
2866 3300022467 Ga0224712_10158132 Ga0224712_101581322 91
2867 3300023309 Ga0256744_133841 Ga0256744_1338412 91
2868 3300025206 Ga0209435_100019 Ga0209435_1000197 91
2869 3300025207 Ga0209760_100117 Ga0209760_10011743 91
2870 3300025207 Ga0209760_100346 Ga0209760_10034622 91
2871 3300025208 Ga0209436_103689 Ga0209436_1036896 91
2872 3300025208 Ga0209436_118242 Ga0209436_1182423 91
2873 3300025224 Ga0209784_100060 Ga0209784_10006026 91
2874 3300025225 Ga0209566_100075 Ga0209566_10007526 91
2875 3300025226 Ga0209674_100100 Ga0209674_10010026 91
2876 3300025228 Ga0209672_101179 Ga0209672_10117915 91
2877 3300025229 Ga0209147_100096 Ga0209147_10009626 91
2878 3300025229 Ga0209147_101231 Ga0209147_1012318 91
2879 3300025230 Ga0209563_100195 Ga0209563_10019523 91
2880 3300025231 Ga0207427_103986 Ga0207427_1039864 91
2881 3300025233 Ga0209437_106609 Ga0209437_1066093 91
2882 3300025242 Ga0209258_100387 Ga0209258_10038726 91
2883 3300025242 Ga0209258_100696 Ga0209258_10069626 91
2884 3300025245 Ga0207425_1000562 Ga0207425_100056226 91
2885 3300025245 Ga0207425_1007236 Ga0207425_10072364 91
2886 3300025246 Ga0209646_1000038 Ga0209646_10000387 91
2887 3300025246 Ga0209646_1000276 Ga0209646_100027611 91
2888 3300025250 Ga0209026_1000048 Ga0209026_10000487 91
2889 3300025253 Ga0209677_100057 Ga0209677_10005726 91
2890 3300025254 Ga0209148_1000122 Ga0209148_1000122180 91
2891 3300025256 Ga0209759_1000038 Ga0209759_1000038237 91
2892 3300025256 Ga0209759_1003338 Ga0209759_10033387 91
2893 3300025256 Ga0209759_1042567 Ga0209759_10425672 91
2894 3300025258 Ga0209129_1005151 Ga0209129_10051514 91
2895 3300025258 Ga0209129_1021901 Ga0209129_10219013 91
2896 3300025261 Ga0209233_1000133 Ga0209233_100013327 91
2897 3300025261 Ga0209233_1000870 Ga0209233_100087021 91
2898 3300025263 Ga0209565_1000309 Ga0209565_100030953 91
2899 3300025263 Ga0209565_1007212 Ga0209565_10072123 91
2900 3300025263 Ga0209565_1019609 Ga0209565_10196091 91
2901 3300025273 Ga0209673_1000088 Ga0209673_1000088200 91
2902 3300025273 Ga0209673_1000690 Ga0209673_100069051 91
2903 3300025273 Ga0209673_1036952 Ga0209673_10369521 91
2904 3300025284 Ga0209130_1004268 Ga0209130_10042686 91
2905 3300025284 Ga0209130_1008830 Ga0209130_10088301 91
2906 3300025284 Ga0209130_1012588 Ga0209130_10125882 91
2907 3300025291 Ga0209675_1000093 Ga0209675_1000093141 91
2908 3300025291 Ga0209675_1001254 Ga0209675_100125415 91
2909 3300025291 Ga0209675_1003419 Ga0209675_10034198 91
2910 3300025291 Ga0209675_1005023 Ga0209675_10050238 91
2911 3300025292 Ga0209676_1001499 Ga0209676_100149923 91
2912 3300025292 Ga0209676_1004912 Ga0209676_10049124 91
2913 3300025292 Ga0209676_1005292 Ga0209676_100529215 91
2914 3300025292 Ga0209676_1007252 Ga0209676_100725213 91
2915 3300025292 Ga0209676_1007792 Ga0209676_10077926 91
2916 3300025294 Ga0209025_1022034 Ga0209025_10220343 91
2917 3300025294 Ga0209025_1024539 Ga0209025_10245394 91
2918 3300025294 Ga0209025_1073277 Ga0209025_10732772 91
2919 3300025295 Ga0209564_1008261 Ga0209564_10082614 91
2920 3300025295 Ga0209564_1023162 Ga0209564_10231621 91
2921 3300025295 Ga0209564_1057033 Ga0209564_10570332 91
2922 3300025297 Ga0209758_1006854 Ga0209758_10068548 91
2923 3300025297 Ga0209758_1024237 Ga0209758_10242372 91
2924 3300025298 Ga0209050_1000008 Ga0209050_1000008761 91
2925 3300025298 Ga0209050_1000063 Ga0209050_10000637 91
2926 3300025298 Ga0209050_1000224 Ga0209050_1000224130 91
2927 3300025298 Ga0209050_1003182 Ga0209050_100318223 91
2928 3300025298 Ga0209050_1032610 Ga0209050_10326103 91
2929 3300025299 Ga0209256_1000096 Ga0209256_10000967 91
2930 3300025299 Ga0209256_1019390 Ga0209256_10193901 91
2931 3300025302 Ga0207426_1007056 Ga0207426_10070567 91
2932 3300025302 Ga0207426_1022436 Ga0207426_10224361 91
2933 3300025303 Ga0209051_1000005 Ga0209051_1000005761 91
2934 3300025303 Ga0209051_1000313 Ga0209051_10003139 91
2935 3300025303 Ga0209051_1000690 Ga0209051_100069043 91
2936 3300025303 Ga0209051_1009153 Ga0209051_10091539 91
2937 3300025303 Ga0209051_1021704 Ga0209051_10217044 91
2938 3300025303 Ga0209051_1040883 Ga0209051_10408833 91
2939 3300025303 Ga0209051_1092924 Ga0209051_10929241 91
2940 3300025304 Ga0209257_1000031 Ga0209257_1000031351 91
2941 3300025304 Ga0209257_1000163 Ga0209257_10001632 91
2942 3300025304 Ga0209257_1003420 Ga0209257_100342022 91
2943 3300025304 Ga0209257_1026773 Ga0209257_10267732 91
2944 3300025304 Ga0209257_1049327 Ga0209257_10493272 91
2945 3300025315 Ga0207697_10331186 Ga0207697_103311862 91
2946 3300025321 Ga0207656_10000010 Ga0207656_1000001025 91
2947 3300025321 Ga0207656_10011428 Ga0207656_100114284 91
2948 3300025321 Ga0207656_10014326 Ga0207656_100143264 91
2949 3300025321 Ga0207656_10079985 Ga0207656_100799852 91
2950 3300025711 Ga0207696_1000118 Ga0207696_10001187 91
2951 3300025711 Ga0207696_1005443 Ga0207696_100544312 91
2952 3300025728 Ga0207655_1001405 Ga0207655_100140525 91
2953 3300025728 Ga0207655_1006327 Ga0207655_100632717 91
2954 3300025728 Ga0207655_1043489 Ga0207655_10434894 91
2955 3300025735 Ga0207713_1007360 Ga0207713_10073609 91
2956 3300025735 Ga0207713_1008183 Ga0207713_10081836 91
2957 3300025735 Ga0207713_1015828 Ga0207713_10158282 91
2958 3300025893 Ga0207682_10017956 Ga0207682_100179566 91
2959 3300025893 Ga0207682_10072846 Ga0207682_100728463 91
2960 3300025899 Ga0207642_11001076 Ga0207642_110010762 91
2961 3300025901 Ga0207688_10130022 Ga0207688_101300223 91
2962 3300025903 Ga0207680_10018972 Ga0207680_100189722 91
2963 3300025903 Ga0207680_10088435 Ga0207680_100884352 91
2964 3300025903 Ga0207680_10951788 Ga0207680_109517881 91
2965 3300025904 Ga0207647_10012806 Ga0207647_100128064 91
2966 3300025904 Ga0207647_10072505 Ga0207647_100725053 91
2967 3300025904 Ga0207647_10104101 Ga0207647_101041013 91
2968 3300025905 Ga0207685_10514704 Ga0207685_105147042 91
2969 3300025908 Ga0207643_10451935 Ga0207643_104519352 91
2970 3300025909 Ga0207705_10004273 Ga0207705_100042737 91
2971 3300025909 Ga0207705_10008046 Ga0207705_100080467 91
2972 3300025909 Ga0207705_10011179 Ga0207705_1001117913 91
2973 3300025909 Ga0207705_10034450 Ga0207705_100344507 91
2974 3300025909 Ga0207705_10389212 Ga0207705_103892122 91
2975 3300025909 Ga0207705_10692956 Ga0207705_106929562 91
2976 3300025909 Ga0207705_11120956 Ga0207705_111209561 91
2977 3300025910 Ga0207684_10466006 Ga0207684_104660062 91
2978 3300025912 Ga0207707_10000210 Ga0207707_100002107 91
2979 3300025912 Ga0207707_10001339 Ga0207707_100013397 91
2980 3300025912 Ga0207707_10007312 Ga0207707_100073126 91
2981 3300025912 Ga0207707_10010320 Ga0207707_1001032017 91
2982 3300025912 Ga0207707_10052498 Ga0207707_100524982 91
2983 3300025912 Ga0207707_10096300 Ga0207707_100963002 91
2984 3300025912 Ga0207707_10650591 Ga0207707_106505911 91
2985 3300025913 Ga0207695_10000929 Ga0207695_1000092928 91
2986 3300025913 Ga0207695_10006299 Ga0207695_100062997 91
2987 3300025913 Ga0207695_10022941 Ga0207695_1002294114 91
2988 3300025913 Ga0207695_10068969 Ga0207695_100689692 91
2989 3300025913 Ga0207695_10073537 Ga0207695_100735377 91
2990 3300025913 Ga0207695_10089423 Ga0207695_100894233 91
2991 3300025913 Ga0207695_10221098 Ga0207695_102210982 91
2992 3300025913 Ga0207695_10231011 Ga0207695_102310113 91
2993 3300025913 Ga0207695_10549682 Ga0207695_105496823 91
2994 3300025914 Ga0207671_10000380 Ga0207671_1000038068 91
2995 3300025914 Ga0207671_10033016 Ga0207671_100330164 91
2996 3300025914 Ga0207671_10166846 Ga0207671_101668463 91
2997 3300025914 Ga0207671_10624052 Ga0207671_106240522 91
2998 3300025914 Ga0207671_10754760 Ga0207671_107547602 91
2999 3300025914 Ga0207671_11008685 Ga0207671_110086852 91
3000 3300025915 Ga0207693_11185482 Ga0207693_111854822 91
3001 3300025916 Ga0207663_10139445 Ga0207663_101394453 91
3002 3300025917 Ga0207660_10036194 Ga0207660_100361947 91
3003 3300025917 Ga0207660_10047040 Ga0207660_100470407 91
3004 3300025917 Ga0207660_10115224 Ga0207660_101152243 91
3005 3300025917 Ga0207660_10188182 Ga0207660_101881822 91
3006 3300025917 Ga0207660_10201342 Ga0207660_102013422 91
3007 3300025917 Ga0207660_10616360 Ga0207660_106163602 91
3008 3300025917 Ga0207660_10649311 Ga0207660_106493112 91
3009 3300025918 Ga0207662_10346196 Ga0207662_103461963 91
3010 3300025919 Ga0207657_10023563 Ga0207657_1002356311 91
3011 3300025919 Ga0207657_10055348 Ga0207657_100553487 91
3012 3300025919 Ga0207657_10090313 Ga0207657_100903132 91
3013 3300025919 Ga0207657_10097904 Ga0207657_100979044 91
3014 3300025919 Ga0207657_10214820 Ga0207657_102148202 91
3015 3300025919 Ga0207657_10256491 Ga0207657_102564912 91
3016 3300025920 Ga0207649_10000041 Ga0207649_10000041106 91
3017 3300025920 Ga0207649_10002213 Ga0207649_100022137 91
3018 3300025920 Ga0207649_10023404 Ga0207649_100234041 91
3019 3300025920 Ga0207649_10024587 Ga0207649_100245876 91
3020 3300025920 Ga0207649_10112764 Ga0207649_101127642 91
3021 3300025920 Ga0207649_10439918 Ga0207649_104399182 91
3022 3300025920 Ga0207649_11042938 Ga0207649_110429381 91
3023 3300025920 Ga0207649_11666929 Ga0207649_116669291 91
3024 3300025921 Ga0207652_10005745 Ga0207652_100057453 91
3025 3300025921 Ga0207652_10048121 Ga0207652_100481212 91
3026 3300025921 Ga0207652_10053020 Ga0207652_100530207 91
3027 3300025921 Ga0207652_10193163 Ga0207652_101931633 91
3028 3300025921 Ga0207652_10432066 Ga0207652_104320662 91
3029 3300025921 Ga0207652_10648648 Ga0207652_106486481 91
3030 3300025921 Ga0207652_10752775 Ga0207652_107527752 91
3031 3300025922 Ga0207646_11197141 Ga0207646_111971412 91
3032 3300025923 Ga0207681_10010421 Ga0207681_100104219 91
3033 3300025923 Ga0207681_10042588 Ga0207681_100425887 91
3034 3300025923 Ga0207681_10348828 Ga0207681_103488282 91
3035 3300025924 Ga0207694_10028049 Ga0207694_100280492 91
3036 3300025924 Ga0207694_10028197 Ga0207694_100281977 91
3037 3300025924 Ga0207694_10129175 Ga0207694_101291754 91
3038 3300025925 Ga0207650_10016653 Ga0207650_100166537 91
3039 3300025925 Ga0207650_10257240 Ga0207650_102572402 91
3040 3300025925 Ga0207650_10324590 Ga0207650_103245902 91
3041 3300025925 Ga0207650_10530806 Ga0207650_105308062 91
3042 3300025926 Ga0207659_10518790 Ga0207659_105187902 91
3043 3300025927 Ga0207687_10056115 Ga0207687_100561153 91
3044 3300025927 Ga0207687_10580124 Ga0207687_105801242 91
3045 3300025927 Ga0207687_10792469 Ga0207687_107924693 91
3046 3300025927 Ga0207687_11624171 Ga0207687_116241712 91
3047 3300025928 Ga0207700_10280404 Ga0207700_102804043 91
3048 3300025928 Ga0207700_11637106 Ga0207700_116371061 91
3049 3300025931 Ga0207644_10117662 Ga0207644_101176622 91
3050 3300025931 Ga0207644_10231687 Ga0207644_102316872 91
3051 3300025931 Ga0207644_10875886 Ga0207644_108758862 91
3052 3300025932 Ga0207690_10003289 Ga0207690_100032897 91
3053 3300025932 Ga0207690_10086236 Ga0207690_100862364 91
3054 3300025932 Ga0207690_11443849 Ga0207690_114438492 91
3055 3300025933 Ga0207706_10015708 Ga0207706_100157085 91
3056 3300025933 Ga0207706_10019984 Ga0207706_100199843 91
3057 3300025933 Ga0207706_10035411 Ga0207706_100354119 91
3058 3300025933 Ga0207706_10271889 Ga0207706_102718892 91
3059 3300025934 Ga0207686_10029651 Ga0207686_100296518 91
3060 3300025934 Ga0207686_10482903 Ga0207686_104829032 91
3061 3300025934 Ga0207686_10689356 Ga0207686_106893562 91
3062 3300025934 Ga0207686_11784269 Ga0207686_117842691 91
3063 3300025935 Ga0207709_10000030 Ga0207709_100000302 91
3064 3300025935 Ga0207709_10048725 Ga0207709_100487252 91
3065 3300025935 Ga0207709_10389491 Ga0207709_103894912 91
3066 3300025937 Ga0207669_10086024 Ga0207669_100860242 91
3067 3300025937 Ga0207669_10212828 Ga0207669_102128283 91
3068 3300025938 Ga0207704_10017680 Ga0207704_100176804 91
3069 3300025938 Ga0207704_11957973 Ga0207704_119579732 91
3070 3300025939 Ga0207665_10227981 Ga0207665_102279813 91
3071 3300025940 Ga0207691_10483730 Ga0207691_104837302 91
3072 3300025941 Ga0207711_10000272 Ga0207711_1000027220 91
3073 3300025941 Ga0207711_10035850 Ga0207711_100358506 91
3074 3300025941 Ga0207711_10207309 Ga0207711_102073094 91
3075 3300025941 Ga0207711_10639839 Ga0207711_106398393 91
3076 3300025942 Ga0207689_10030047 Ga0207689_100300479 91
3077 3300025944 Ga0207661_10004252 Ga0207661_100042527 91
3078 3300025944 Ga0207661_10014188 Ga0207661_100141882 91
3079 3300025944 Ga0207661_10034115 Ga0207661_100341157 91
3080 3300025944 Ga0207661_10207525 Ga0207661_102075252 91
3081 3300025945 Ga0207679_10000081 Ga0207679_1000008169 91
3082 3300025945 Ga0207679_10007494 Ga0207679_100074944 91
3083 3300025945 Ga0207679_10025524 Ga0207679_100255243 91
3084 3300025945 Ga0207679_10338335 Ga0207679_103383352 91
3085 3300025945 Ga0207679_10671473 Ga0207679_106714732 91
3086 3300025949 Ga0207667_10008758 Ga0207667_1000875819 91
3087 3300025949 Ga0207667_10009904 Ga0207667_1000990418 91
3088 3300025949 Ga0207667_10010803 Ga0207667_100108037 91
3089 3300025949 Ga0207667_10069206 Ga0207667_100692067 91
3090 3300025949 Ga0207667_10072769 Ga0207667_100727697 91
3091 3300025949 Ga0207667_10083800 Ga0207667_100838002 91
3092 3300025949 Ga0207667_10405437 Ga0207667_104054371 91
3093 3300025949 Ga0207667_10557868 Ga0207667_105578682 91
3094 3300025949 Ga0207667_10882191 Ga0207667_108821912 91
3095 3300025949 Ga0207667_11168526 Ga0207667_111685262 91
3096 3300025949 Ga0207667_12132014 Ga0207667_121320142 91
3097 3300025961 Ga0207712_10003232 Ga0207712_100032328 91
3098 3300025961 Ga0207712_10825864 Ga0207712_108258642 91
3099 3300025961 Ga0207712_11160788 Ga0207712_111607881 91
3100 3300025972 Ga0207668_10261487 Ga0207668_102614872 91
3101 3300025972 Ga0207668_11163965 Ga0207668_111639652 91
3102 3300025981 Ga0207640_10002025 Ga0207640_1000202517 91
3103 3300025981 Ga0207640_10002539 Ga0207640_1000253917 91
3104 3300025981 Ga0207640_10025408 Ga0207640_100254087 91
3105 3300025981 Ga0207640_10026008 Ga0207640_100260087 91
3106 3300025981 Ga0207640_10081681 Ga0207640_100816812 91
3107 3300025981 Ga0207640_10108477 Ga0207640_101084772 91
3108 3300025981 Ga0207640_10112801 Ga0207640_101128013 91
3109 3300025981 Ga0207640_10181952 Ga0207640_101819523 91
3110 3300025981 Ga0207640_11729958 Ga0207640_117299582 91
3111 3300025986 Ga0207658_10000028 Ga0207658_10000028167 91
3112 3300025986 Ga0207658_10182810 Ga0207658_101828104 91
3113 3300025986 Ga0207658_10184950 Ga0207658_101849502 91
3114 3300025986 Ga0207658_10407696 Ga0207658_104076961 91
3115 3300025986 Ga0207658_10485435 Ga0207658_104854353 91
3116 3300025986 Ga0207658_10830855 Ga0207658_108308552 91
3117 3300026023 Ga0207677_10318665 Ga0207677_103186652 91
3118 3300026023 Ga0207677_11670871 Ga0207677_116708712 91
3119 3300026035 Ga0207703_10497605 Ga0207703_104976052 91
3120 3300026035 Ga0207703_10978787 Ga0207703_109787871 91
3121 3300026035 Ga0207703_11409684 Ga0207703_114096842 91
3122 3300026041 Ga0207639_10000231 Ga0207639_1000023111 91
3123 3300026041 Ga0207639_10000396 Ga0207639_1000039617 91
3124 3300026041 Ga0207639_10024406 Ga0207639_100244062 91
3125 3300026041 Ga0207639_10029641 Ga0207639_100296417 91
3126 3300026041 Ga0207639_10047428 Ga0207639_100474282 91
3127 3300026041 Ga0207639_10062778 Ga0207639_100627784 91
3128 3300026041 Ga0207639_10070937 Ga0207639_100709373 91
3129 3300026041 Ga0207639_10104151 Ga0207639_101041512 91
3130 3300026041 Ga0207639_10485855 Ga0207639_104858553 91
3131 3300026041 Ga0207639_10532135 Ga0207639_105321352 91
3132 3300026041 Ga0207639_10582310 Ga0207639_105823103 91
3133 3300026067 Ga0207678_10047631 Ga0207678_100476318 91
3134 3300026067 Ga0207678_10055028 Ga0207678_100550287 91
3135 3300026067 Ga0207678_10057247 Ga0207678_100572475 91
3136 3300026067 Ga0207678_10094762 Ga0207678_100947624 91
3137 3300026067 Ga0207678_10103355 Ga0207678_101033554 91
3138 3300026067 Ga0207678_10151436 Ga0207678_101514362 91
3139 3300026067 Ga0207678_10219037 Ga0207678_102190374 91
3140 3300026067 Ga0207678_10242893 Ga0207678_102428932 91
3141 3300026067 Ga0207678_10289173 Ga0207678_102891733 91
3142 3300026075 Ga0207708_10558693 Ga0207708_105586932 91
3143 3300026078 Ga0207702_10011901 Ga0207702_1001190110 91
3144 3300026078 Ga0207702_10012283 Ga0207702_1001228310 91
3145 3300026078 Ga0207702_10022553 Ga0207702_1002255311 91
3146 3300026078 Ga0207702_10063459 Ga0207702_100634592 91
3147 3300026078 Ga0207702_10113493 Ga0207702_101134934 91
3148 3300026078 Ga0207702_10170737 Ga0207702_101707373 91
3149 3300026078 Ga0207702_12528685 Ga0207702_125286852 91
3150 3300026088 Ga0207641_10009230 Ga0207641_1000923014 91
3151 3300026088 Ga0207641_11178421 Ga0207641_111784211 91
3152 3300026088 Ga0207641_11833810 Ga0207641_118338102 91
3153 3300026089 Ga0207648_10363711 Ga0207648_103637112 91
3154 3300026095 Ga0207676_10222560 Ga0207676_102225603 91
3155 3300026116 Ga0207674_10003713 Ga0207674_1000371311 91
3156 3300026116 Ga0207674_10017287 Ga0207674_100172877 91
3157 3300026116 Ga0207674_10092556 Ga0207674_100925565 91
3158 3300026116 Ga0207674_10125306 Ga0207674_101253063 91
3159 3300026116 Ga0207674_10126554 Ga0207674_101265542 91
3160 3300026116 Ga0207674_10128644 Ga0207674_101286445 91
3161 3300026116 Ga0207674_10234014 Ga0207674_102340143 91
3162 3300026116 Ga0207674_10408759 Ga0207674_104087593 91
3163 3300026116 Ga0207674_10819092 Ga0207674_108190922 91
3164 3300026116 Ga0207674_11856537 Ga0207674_118565372 91
3165 3300026116 Ga0207674_11938575 Ga0207674_119385751 91
3166 3300026118 Ga0207675_101969492 Ga0207675_1019694921 91
3167 3300026121 Ga0207683_10301010 Ga0207683_103010102 91
3168 3300026142 Ga0207698_10004871 Ga0207698_100048717 91
3169 3300026142 Ga0207698_10007267 Ga0207698_100072677 91
3170 3300026142 Ga0207698_10038635 Ga0207698_100386352 91
3171 3300026142 Ga0207698_10189246 Ga0207698_101892462 91
3172 3300026142 Ga0207698_10249127 Ga0207698_102491272 91
3173 3300027111 Ga0209281_1001754 Ga0209281_100175422 91
3174 3300027111 Ga0209281_1015163 Ga0209281_10151633 91
3175 3300027252 Ga0209973_1053138 Ga0209973_10531382 91
3176 3300027296 Ga0209389_1000020 Ga0209389_100002027 91
3177 3300027312 Ga0209371_1001079 Ga0209371_10010792 91
3178 3300027312 Ga0209371_1005890 Ga0209371_10058902 91
3179 3300027312 Ga0209371_1021579 Ga0209371_10215793 91
3180 3300027364 Ga0209967_1000535 Ga0209967_100053510 91
3181 3300027378 Ga0209981_1000236 Ga0209981_100023611 91
3182 3300027378 Ga0209981_1048812 Ga0209981_10488122 91
3183 3300027395 Ga0209996_1000952 Ga0209996_10009524 91
3184 3300027395 Ga0209996_1005456 Ga0209996_10054564 91
3185 3300027424 Ga0209984_1001060 Ga0209984_10010607 91
3186 3300027424 Ga0209984_1061988 Ga0209984_10619882 91
3187 3300027462 Ga0210000_1043586 Ga0210000_10435862 91
3188 3300027471 Ga0209995_1003495 Ga0209995_10034952 91
3189 3300027471 Ga0209995_1029750 Ga0209995_10297502 91
3190 3300027471 Ga0209995_1042702 Ga0209995_10427021 91
3191 3300027526 Ga0209968_1000211 Ga0209968_100021111 91
3192 3300027526 Ga0209968_1004689 Ga0209968_10046894 91
3193 3300027526 Ga0209968_1039003 Ga0209968_10390032 91
3194 3300027543 Ga0209999_1006848 Ga0209999_10068484 91
3195 3300027543 Ga0209999_1024505 Ga0209999_10245053 91
3196 3300027552 Ga0209982_1000234 Ga0209982_10002347 91
3197 3300027552 Ga0209982_1006918 Ga0209982_10069182 91
3198 3300027614 Ga0209970_1001981 Ga0209970_10019812 91
3199 3300027614 Ga0209970_1002825 Ga0209970_10028258 91
3200 3300027614 Ga0209970_1005400 Ga0209970_10054005 91
3201 3300027617 Ga0210002_1004626 Ga0210002_10046265 91
3202 3300027617 Ga0210002_1006186 Ga0210002_10061863 91
3203 3300027617 Ga0210002_1023540 Ga0210002_10235402 91
3204 3300027617 Ga0210002_1072477 Ga0210002_10724771 91
3205 3300027665 Ga0209983_1000912 Ga0209983_10009128 91
3206 3300027665 Ga0209983_1038177 Ga0209983_10381773 91
3207 3300027666 Ga0209282_1009935 Ga0209282_100993510 91
3208 3300027666 Ga0209282_1011026 Ga0209282_10110261 91
3209 3300027682 Ga0209971_1029202 Ga0209971_10292022 91
3210 3300027866 Ga0209813_10204420 Ga0209813_102044201 91
3211 3300027866 Ga0209813_10208851 Ga0209813_102088512 91
3212 3300027876 Ga0209974_10002411 Ga0209974_100024119 91
3213 3300027876 Ga0209974_10006827 Ga0209974_100068277 91
3214 3300027876 Ga0209974_10030379 Ga0209974_100303793 91
3215 3300027876 Ga0209974_10058672 Ga0209974_100586722 91
3216 3300027876 Ga0209974_10229779 Ga0209974_102297792 91
3217 3300027907 Ga0207428_10003152 Ga0207428_100031528 91
3218 3300027907 Ga0207428_10069564 Ga0207428_100695647 91
3219 3300028379 Ga0268266_10252838 Ga0268266_102528383 91
3220 3300028379 Ga0268266_10427091 Ga0268266_104270913 91
3221 3300028379 Ga0268266_10758477 Ga0268266_107584772 91
3222 3300028379 Ga0268266_10896588 Ga0268266_108965882 91
3223 3300028380 Ga0268265_10053630 Ga0268265_100536302 91
3224 3300028380 Ga0268265_10346354 Ga0268265_103463543 91
3225 3300028381 Ga0268264_10337557 Ga0268264_103375573 91
3226 3300028381 Ga0268264_10420078 Ga0268264_104200782 91
3227 3300028381 Ga0268264_12670344 Ga0268264_126703442 91
3228 3300028666 Ga0265336_10092689 Ga0265336_100926893 91
3229 3300028786 Ga0307517_10129027 Ga0307517_101290273 91
3230 3300028786 Ga0307517_10165527 Ga0307517_101655273 91
3231 3300028794 Ga0307515_10000861 Ga0307515_1000086167 91
3232 3300028794 Ga0307515_10177587 Ga0307515_101775874 91
3233 3300028794 Ga0307515_10221417 Ga0307515_102214173 91
3234 3300028794 Ga0307515_10353691 Ga0307515_103536912 91
3235 3300030500 Ga0268256_1000913 Ga0268256_100091320 91
3236 3300030500 Ga0268256_1005183 Ga0268256_10051832 91
3237 3300030500 Ga0268256_1034042 Ga0268256_10340422 91
3238 3300030522 Ga0307512_10114450 Ga0307512_101144503 91
3239 3300030731 Ga0316177_1000096 Ga0316177_10000964 91
3240 3300030731 Ga0316177_1071442 Ga0316177_10714422 91
3241 3300030731 Ga0316177_1209611 Ga0316177_12096111 91
3242 3300030733 Ga0314311_1032260 Ga0314311_10322605 91
3243 3300030733 Ga0314311_1061156 Ga0314311_10611562 91
3244 3300030734 Ga0316179_1058443 Ga0316179_10584432 91
3245 3300030734 Ga0316179_1068488 Ga0316179_10684885 91
3246 3300030735 Ga0316178_1000695 Ga0316178_10006957 91
3247 3300030735 Ga0316178_1033068 Ga0316178_10330685 91
3248 3300030736 Ga0316180_1139357 Ga0316180_11393572 91
3249 3300030742 Ga0316183_1014056 Ga0316183_10140562 91
3250 3300030742 Ga0316183_1116531 Ga0316183_11165313 91
3251 3300030744 Ga0316181_1171352 Ga0316181_11713522 91
3252 3300030744 Ga0316181_1175235 Ga0316181_11752353 91
3253 3300030745 Ga0316182_1163179 Ga0316182_11631794 91
3254 3300031235 Ga0265330_10324192 Ga0265330_103241922 91
3255 3300031238 Ga0265332_10000022 Ga0265332_100000227 91
3256 3300031239 Ga0265328_10035480 Ga0265328_100354803 91
3257 3300031251 Ga0265327_10007434 Ga0265327_100074343 91
3258 3300031251 Ga0265327_10010616 Ga0265327_100106168 91
3259 3300031344 Ga0265316_10740308 Ga0265316_107403082 91
3260 3300031456 Ga0307513_10082984 Ga0307513_100829842 91
3261 3300031456 Ga0307513_10154898 Ga0307513_101548982 91
3262 3300031456 Ga0307513_10277662 Ga0307513_102776623 91
3263 3300031548 Ga0307408_100028561 Ga0307408_1000285617 91
3264 3300031548 Ga0307408_100188047 Ga0307408_1001880473 91
3265 3300031548 Ga0307408_100202669 Ga0307408_1002026692 91
3266 3300031548 Ga0307408_100304887 Ga0307408_1003048872 91
3267 3300031548 Ga0307408_100435788 Ga0307408_1004357883 91
3268 3300031548 Ga0307408_101364586 Ga0307408_1013645861 91
3269 3300031616 Ga0307508_10063395 Ga0307508_100633957 91
3270 3300031616 Ga0307508_10166732 Ga0307508_101667324 91
3271 3300031649 Ga0307514_10017304 Ga0307514_100173042 91
3272 3300031665 Ga0316575_10004197 Ga0316575_1000419710 91
3273 3300031665 Ga0316575_10092362 Ga0316575_100923621 91
3274 3300031665 Ga0316575_10146133 Ga0316575_101461333 91
3275 3300031667 Ga0310111_116507 Ga0310111_1165071 91
3276 3300031691 Ga0316579_10000104 Ga0316579_1000010431 91
3277 3300031691 Ga0316579_10003374 Ga0316579_100033744 91
3278 3300031691 Ga0316579_10003462 Ga0316579_100034628 91
3279 3300031691 Ga0316579_10067686 Ga0316579_100676864 91
3280 3300031691 Ga0316579_10092232 Ga0316579_100922322 91
3281 3300031691 Ga0316579_10097316 Ga0316579_100973162 91
3282 3300031691 Ga0316579_10234115 Ga0316579_102341152 91
3283 3300031711 Ga0265314_10146240 Ga0265314_101462402 91
3284 3300031712 Ga0265342_10069404 Ga0265342_100694043 91
3285 3300031727 Ga0316576_10000067 Ga0316576_1000006722 91
3286 3300031727 Ga0316576_10000365 Ga0316576_1000036525 91
3287 3300031727 Ga0316576_10000685 Ga0316576_1000068522 91
3288 3300031727 Ga0316576_10009807 Ga0316576_1000980714 91
3289 3300031727 Ga0316576_10014200 Ga0316576_100142004 91
3290 3300031727 Ga0316576_10016311 Ga0316576_100163114 91
3291 3300031727 Ga0316576_10061906 Ga0316576_100619063 91
3292 3300031727 Ga0316576_10083065 Ga0316576_100830652 91
3293 3300031727 Ga0316576_10389317 Ga0316576_103893172 91
3294 3300031727 Ga0316576_10616186 Ga0316576_106161862 91
3295 3300031727 Ga0316576_10722399 Ga0316576_107223992 91
3296 3300031728 Ga0316578_10000046 Ga0316578_100000467 91
3297 3300031728 Ga0316578_10001214 Ga0316578_1000121417 91
3298 3300031728 Ga0316578_10005380 Ga0316578_100053804 91
3299 3300031728 Ga0316578_10007075 Ga0316578_100070754 91
3300 3300031728 Ga0316578_10030710 Ga0316578_100307102 91
3301 3300031728 Ga0316578_10030997 Ga0316578_100309973 91
3302 3300031728 Ga0316578_10045285 Ga0316578_100452852 91
3303 3300031728 Ga0316578_10069554 Ga0316578_100695542 91
3304 3300031728 Ga0316578_10142176 Ga0316578_101421762 91
3305 3300031728 Ga0316578_10172215 Ga0316578_101722152 91
3306 3300031728 Ga0316578_10531694 Ga0316578_105316942 91
3307 3300031730 Ga0307516_10165682 Ga0307516_101656824 91
3308 3300031730 Ga0307516_10312302 Ga0307516_103123022 91
3309 3300031731 Ga0307405_10063128 Ga0307405_100631283 91
3310 3300031731 Ga0307405_10076672 Ga0307405_100766724 91
3311 3300031731 Ga0307405_10165128 Ga0307405_101651282 91
3312 3300031731 Ga0307405_10235077 Ga0307405_102350773 91
3313 3300031731 Ga0307405_10427199 Ga0307405_104271992 91
3314 3300031733 Ga0316577_10000967 Ga0316577_1000096724 91
3315 3300031733 Ga0316577_10001071 Ga0316577_1000107120 91
3316 3300031733 Ga0316577_10001498 Ga0316577_1000149819 91
3317 3300031733 Ga0316577_10028940 Ga0316577_100289404 91
3318 3300031733 Ga0316577_10029780 Ga0316577_100297807 91
3319 3300031733 Ga0316577_10033867 Ga0316577_100338674 91
3320 3300031733 Ga0316577_10063207 Ga0316577_100632072 91
3321 3300031824 Ga0307413_10410818 Ga0307413_104108183 91
3322 3300031824 Ga0307413_10412499 Ga0307413_104124992 91
3323 3300031824 Ga0307413_10967460 Ga0307413_109674602 91
3324 3300031824 Ga0307413_11497677 Ga0307413_114976772 91
3325 3300031824 Ga0307413_12050433 Ga0307413_120504331 91
3326 3300031852 Ga0307410_10212029 Ga0307410_102120293 91
3327 3300031852 Ga0307410_11522816 Ga0307410_115228162 91
3328 3300031901 Ga0307406_10015233 Ga0307406_100152336 91
3329 3300031901 Ga0307406_10251115 Ga0307406_102511153 91
3330 3300031901 Ga0307406_11737647 Ga0307406_117376472 91
3331 3300031903 Ga0307407_10448799 Ga0307407_104487992 91
3332 3300031903 Ga0307407_10910141 Ga0307407_109101412 91
3333 3300031911 Ga0307412_10016334 Ga0307412_100163344 91
3334 3300031911 Ga0307412_10168217 Ga0307412_101682173 91
3335 3300031911 Ga0307412_10991807 Ga0307412_109918072 91
3336 3300031911 Ga0307412_11382229 Ga0307412_113822292 91
3337 3300031911 Ga0307412_11638315 Ga0307412_116383151 91
3338 3300031995 Ga0307409_100312744 Ga0307409_1003127442 91
3339 3300031995 Ga0307409_100457705 Ga0307409_1004577053 91
3340 3300032002 Ga0307416_100704121 Ga0307416_1007041211 91
3341 3300032002 Ga0307416_100791406 Ga0307416_1007914062 91
3342 3300032002 Ga0307416_101110345 Ga0307416_1011103451 91
3343 3300032002 Ga0307416_102344064 Ga0307416_1023440642 91
3344 3300032004 Ga0307414_10059491 Ga0307414_100594914 91
3345 3300032004 Ga0307414_10109218 Ga0307414_101092182 91
3346 3300032005 Ga0307411_10401214 Ga0307411_104012143 91
3347 3300032005 Ga0307411_10461159 Ga0307411_104611592 91
3348 3300032005 Ga0307411_10568798 Ga0307411_105687982 91
3349 3300032126 Ga0307415_100468566 Ga0307415_1004685662 91
3350 3300032133 Ga0316583_10016452 Ga0316583_100164524 91
3351 3300032133 Ga0316583_10027138 Ga0316583_100271382 91
3352 3300032133 Ga0316583_10134631 Ga0316583_101346312 91
3353 3300032137 Ga0316585_10000029 Ga0316585_100000297 91
3354 3300032137 Ga0316585_10009602 Ga0316585_100096024 91
3355 3300032137 Ga0316585_10010564 Ga0316585_100105644 91
3356 3300032137 Ga0316585_10064197 Ga0316585_100641973 91
3357 3300032137 Ga0316585_10075624 Ga0316585_100756243 91
3358 3300032137 Ga0316585_10117149 Ga0316585_101171492 91
3359 3300032139 Ga0316580_10000016 Ga0316580_1000001633 91
3360 3300032139 Ga0316580_10000485 Ga0316580_1000048518 91
3361 3300032139 Ga0316580_10002303 Ga0316580_100023033 91
3362 3300032139 Ga0316580_10006329 Ga0316580_100063292 91
3363 3300032139 Ga0316580_10200069 Ga0316580_102000692 91
3364 3300032139 Ga0316580_10246234 Ga0316580_102462342 91
3365 3300032168 Ga0316593_10000041 Ga0316593_1000004124 91
3366 3300032168 Ga0316593_10000096 Ga0316593_1000009617 91
3367 3300032168 Ga0316593_10000167 Ga0316593_100001674 91
3368 3300032168 Ga0316593_10000257 Ga0316593_100002572 91
3369 3300032168 Ga0316593_10000267 Ga0316593_1000026714 91
3370 3300032168 Ga0316593_10000387 Ga0316593_100003877 91
3371 3300032168 Ga0316593_10001228 Ga0316593_100012286 91
3372 3300032168 Ga0316593_10001676 Ga0316593_100016769 91
3373 3300032168 Ga0316593_10001882 Ga0316593_100018823 91
3374 3300032168 Ga0316593_10001960 Ga0316593_100019604 91
3375 3300032168 Ga0316593_10002176 Ga0316593_100021766 91
3376 3300032168 Ga0316593_10003521 Ga0316593_100035211 91
3377 3300032168 Ga0316593_10004311 Ga0316593_100043112 91
3378 3300032168 Ga0316593_10004886 Ga0316593_100048863 91
3379 3300032168 Ga0316593_10005293 Ga0316593_100052931 91
3380 3300032168 Ga0316593_10007086 Ga0316593_100070862 91
3381 3300032168 Ga0316593_10007176 Ga0316593_100071766 91
3382 3300032168 Ga0316593_10010076 Ga0316593_100100767 91
3383 3300032168 Ga0316593_10011741 Ga0316593_100117411 91
3384 3300032168 Ga0316593_10013327 Ga0316593_100133272 91
3385 3300032168 Ga0316593_10017987 Ga0316593_100179874 91
3386 3300032168 Ga0316593_10020625 Ga0316593_100206254 91
3387 3300032168 Ga0316593_10026445 Ga0316593_100264453 91
3388 3300032168 Ga0316593_10029669 Ga0316593_100296692 91
3389 3300032168 Ga0316593_10047085 Ga0316593_100470852 91
3390 3300032168 Ga0316593_10062678 Ga0316593_100626782 91
3391 3300032168 Ga0316593_10065593 Ga0316593_100655931 91
3392 3300032168 Ga0316593_10080966 Ga0316593_100809662 91
3393 3300032168 Ga0316593_10083019 Ga0316593_100830191 91
3394 3300032168 Ga0316593_10113106 Ga0316593_101131063 91
3395 3300032168 Ga0316593_10126504 Ga0316593_101265041 91
3396 3300032168 Ga0316593_10144186 Ga0316593_101441861 91
3397 3300032168 Ga0316593_10209127 Ga0316593_102091271 91
3398 3300032168 Ga0316593_10229398 Ga0316593_102293982 91
3399 3300032168 Ga0316593_10257614 Ga0316593_102576142 91
3400 3300032168 Ga0316593_10288698 Ga0316593_102886981 91
3401 3300033179 Ga0307507_10073024 Ga0307507_100730243 91
3402 3300033524 Ga0316592_1000041 Ga0316592_100004117 91
3403 3300033524 Ga0316592_1000052 Ga0316592_10000526 91
3404 3300033524 Ga0316592_1000138 Ga0316592_100013817 91
3405 3300033524 Ga0316592_1000456 Ga0316592_10004567 91
3406 3300033524 Ga0316592_1000807 Ga0316592_10008077 91
3407 3300033524 Ga0316592_1001541 Ga0316592_10015414 91
3408 3300033524 Ga0316592_1004425 Ga0316592_10044257 91
3409 3300033524 Ga0316592_1004470 Ga0316592_10044706 91
3410 3300033524 Ga0316592_1018516 Ga0316592_10185163 91
3411 3300033524 Ga0316592_1027376 Ga0316592_10273762 91
3412 3300033524 Ga0316592_1033953 Ga0316592_10339532 91
3413 3300033524 Ga0316592_1038710 Ga0316592_10387102 91
3414 3300033524 Ga0316592_1040253 Ga0316592_10402532 91
3415 3300033524 Ga0316592_1061224 Ga0316592_10612242 91
3416 3300033527 Ga0316586_1000002 Ga0316586_100000220 91
3417 3300033527 Ga0316586_1000064 Ga0316586_10000642 91
3418 3300033527 Ga0316586_1000399 Ga0316586_10003993 91
3419 3300033527 Ga0316586_1000417 Ga0316586_10004177 91
3420 3300033527 Ga0316586_1000436 Ga0316586_10004362 91
3421 3300033527 Ga0316586_1000578 Ga0316586_10005783 91
3422 3300033527 Ga0316586_1000621 Ga0316586_10006213 91
3423 3300033527 Ga0316586_1001553 Ga0316586_10015533 91
3424 3300033527 Ga0316586_1004330 Ga0316586_10043304 91
3425 3300033527 Ga0316586_1014251 Ga0316586_10142512 91
3426 3300033527 Ga0316586_1023229 Ga0316586_10232292 91
3427 3300033527 Ga0316586_1040446 Ga0316586_10404462 91
3428 3300033527 Ga0316586_1051546 Ga0316586_10515462 91
3429 3300033527 Ga0316586_1052014 Ga0316586_10520142 91
3430 3300033528 Ga0316588_1000073 Ga0316588_10000734 91
3431 3300033528 Ga0316588_1000195 Ga0316588_100019510 91
3432 3300033528 Ga0316588_1000300 Ga0316588_10003009 91
3433 3300033528 Ga0316588_1000439 Ga0316588_10004397 91
3434 3300033528 Ga0316588_1000676 Ga0316588_10006767 91
3435 3300033528 Ga0316588_1003121 Ga0316588_10031213 91
3436 3300033528 Ga0316588_1005516 Ga0316588_10055161 91
3437 3300033528 Ga0316588_1005517 Ga0316588_10055171 91
3438 3300033528 Ga0316588_1030488 Ga0316588_10304882 91
3439 3300033528 Ga0316588_1065949 Ga0316588_10659493 91
3440 3300033528 Ga0316588_1095479 Ga0316588_10954792 91
3441 3300033528 Ga0316588_1101879 Ga0316588_11018792 91
3442 3300033528 Ga0316588_1121624 Ga0316588_11216241 91
3443 3300033528 Ga0316588_1148550 Ga0316588_11485502 91
3444 3300033529 Ga0316587_1000351 Ga0316587_10003517 91
3445 3300033529 Ga0316587_1000443 Ga0316587_10004436 91
3446 3300033529 Ga0316587_1000518 Ga0316587_10005182 91
3447 3300033529 Ga0316587_1000623 Ga0316587_10006233 91
3448 3300033529 Ga0316587_1000711 Ga0316587_10007113 91
3449 3300033529 Ga0316587_1002605 Ga0316587_10026054 91
3450 3300033529 Ga0316587_1004402 Ga0316587_10044024 91
3451 3300033529 Ga0316587_1008267 Ga0316587_10082672 91
3452 3300033529 Ga0316587_1010453 Ga0316587_10104533 91
3453 3300033529 Ga0316587_1013771 Ga0316587_10137713 91
3454 3300033529 Ga0316587_1019590 Ga0316587_10195902 91
3455 3300033529 Ga0316587_1033219 Ga0316587_10332192 91
3456 3300033529 Ga0316587_1035170 Ga0316587_10351702 91
3457 3300033529 Ga0316587_1076232 Ga0316587_10762321 91
3458 3300033541 Ga0316596_1000014 Ga0316596_10000147 91
3459 3300033541 Ga0316596_1000017 Ga0316596_100001724 91
3460 3300033541 Ga0316596_1000038 Ga0316596_100003823 91
3461 3300033541 Ga0316596_1000073 Ga0316596_10000731 91
3462 3300033541 Ga0316596_1000123 Ga0316596_10001237 91
3463 3300033541 Ga0316596_1000650 Ga0316596_10006501 91
3464 3300033541 Ga0316596_1000749 Ga0316596_10007498 91
3465 3300033541 Ga0316596_1001024 Ga0316596_10010249 91
3466 3300033541 Ga0316596_1001893 Ga0316596_10018937 91
3467 3300033541 Ga0316596_1002714 Ga0316596_10027143 91
3468 3300033541 Ga0316596_1002901 Ga0316596_10029013 91
3469 3300033541 Ga0316596_1010835 Ga0316596_10108351 91
3470 3300033541 Ga0316596_1011433 Ga0316596_10114333 91
3471 3300033541 Ga0316596_1012776 Ga0316596_10127762 91
3472 3300033541 Ga0316596_1020888 Ga0316596_10208883 91
3473 3300033541 Ga0316596_1037663 Ga0316596_10376633 91
3474 3300033541 Ga0316596_1037782 Ga0316596_10377823 91
3475 3300033541 Ga0316596_1053674 Ga0316596_10536742 91
3476 3300033541 Ga0316596_1094542 Ga0316596_10945422 91
3477 3300033541 Ga0316596_1157555 Ga0316596_11575552 91
3478 3300035089 Ga0373944_0368475 Ga0373944_0368475_18_296 91
3479 3300035091 Ga0373951_0000260 Ga0373951_0000260_13900_14184 91
3480 3300035092 Ga0373952_0261732 Ga0373952_0261732_102_380 91
3481 3300035114 Ga0373939_0510329 Ga0373939_0510329_180_458 91
3482 3300035116 Ga0373945_0201240 Ga0373945_0201240_323_622 91
3483 3300035116 Ga0373945_0225258 Ga0373945_0225258_286_573 91
3484 3300035120 Ga0373957_0319839 Ga0373957_0319839_34_312 91
3485 3300035242 Ga0373962_0131132 Ga0373962_0131132_427_705 91
3486 3300035398 Ga0316574_0007928 Ga0316574_0007928_4692_4970 91
3487 3300035398 Ga0316574_0668900 Ga0316574_0668900_295_576 91
3488 3300035398 Ga0316574_0737311 Ga0316574_0737311_191_469 91
3489 3300035691 Ga0373931_0100547 Ga0373931_0100547_1014_1292 91
3490 3300035695 Ga0373927_0361310 Ga0373927_0361310_573_860 91
3491 3300035695 Ga0373927_0658028 Ga0373927_0658028_312_590 91
3492 3300036401 Ga0373937_0308694 Ga0373937_0308694_704_988 91
3493 3300036401 Ga0373937_0481457 Ga0373937_0481457_373_672 91
3494 3300036401 Ga0373937_1281920 Ga0373937_1281920_54_332 91
3495 3300036647 Ga0316582_0019628 Ga0316582_0019628_387_665 91
3496 3300036647 Ga0316582_0054137 Ga0316582_0054137_1779_2057 91
3497 3300036647 Ga0316582_0118243 Ga0316582_0118243_866_1144 91
3498 3300036712 Ga0316584_0000609 Ga0316584_0000609_2893_3171 91
3499 3300036712 Ga0316584_0004211 Ga0316584_0004211_3052_3330 91
3500 3300036712 Ga0316584_0004833 Ga0316584_0004833_572_850 91
3501 3300036712 Ga0316584_0032167 Ga0316584_0032167_2990_3268 91
3502 3300036712 Ga0316584_0043243 Ga0316584_0043243_541_819 91
3503 3300036712 Ga0316584_0071766 Ga0316584_0071766_1125_1403 91
3504 3300036712 Ga0316584_0749515 Ga0316584_0749515_338_616 91
3505 3300037312 Ga0395899_0042216 Ga0395899_0042216_2911_3204 91
3506 3300037312 Ga0395899_0053921 Ga0395899_0053921_1577_1870 91
3507 3300037312 Ga0395899_0202934 Ga0395899_0202934_395_673 91
3508 3300037418 Ga0395900_0000374 Ga0395900_0000374_3172_3480 91
3509 3300037418 Ga0395900_0037703 Ga0395900_0037703_2146_2457 91
3510 3300037418 Ga0395900_0127994 Ga0395900_0127994_936_1229 91
3511 3300037466 Ga0395898_0044031 Ga0395898_0044031_3196_3489 91
3512 3300037466 Ga0395898_0254868 Ga0395898_0254868_909_1202 91
3513 3300037471 Ga0395905_0029112 Ga0395905_0029112_3484_3762 91
3514 3300037588 Ga0316581_0010269 Ga0316581_0010269_537_815 91
3515 3300037588 Ga0316581_0039938 Ga0316581_0039938_584_862 91
3516 3300038443 Ga0395901_0124834 Ga0395901_0124834_1357_1650 91
3517 3300038443 Ga0395901_0134155 Ga0395901_0134155_2221_2499 91
3518 3300038443 Ga0395901_0227626 Ga0395901_0227626_1160_1438 91
3519 3300038443 Ga0395901_0296585 Ga0395901_0296585_329_622 91
3520 3300038705 Ga0237819_04725 Ga0237819_04725_161_436 91
3521 3300038725 Ga0400484_20003 Ga0400484_20003_3020_3298 91
3522 3300038742 Ga0400486_33075 Ga0400486_33075_5146_5424 91
3523 3300039062 Ga0400483_016430 Ga0400483_016430_1029_1304 91
3524 3300039062 Ga0400483_053664 Ga0400483_053664_199_477 91
3525 3300039062 Ga0400483_248744 Ga0400483_248744_611_889 91
3526 3300039062 Ga0400483_251558 Ga0400483_251558_343_621 91
3527 3300039062 Ga0400483_287520 Ga0400483_287520_877_1152 91
3528 3300039110 Ga0400487_01073 Ga0400487_01073_2618_2893 91
3529 3300039110 Ga0400487_39640 Ga0400487_39640_1450_1725 91
3530 3300039437 Ga0436365_0377119 Ga0436365_0377119_83_361 91
3531 3300039447 Ga0436361_0384522 Ga0436361_0384522_3165_3443 91
3532 3300039450 Ga0436363_0406138 Ga0436363_0406138_225_500 91
3533 3300041404 Ga0439436_0096711 Ga0439436_0096711_294_572 91
3534 3300041405 Ga0439438_039648 Ga0439438_039648_52_330 91
3535 3300041407 Ga0439447_101148 Ga0439447_101148_56_334 91
3536 3300041411 Ga0439466_0168262 Ga0439466_0168262_26_304 91
3537 3300041413 Ga0439465_0048750 Ga0439465_0048750_736_1014 91
3538 3300041413 Ga0439465_0146895 Ga0439465_0146895_534_812 91
3539 3300041441 Ga0451787_099851 Ga0451787_099851_72_356 91
3540 3300041441 Ga0451787_174747 Ga0451787_174747_222_500 91
3541 3300041441 Ga0451787_614450 Ga0451787_614450_23_307 91
3542 3300041442 Ga0451788_07268 Ga0451788_07268_444_722 91
3543 3300041443 Ga0451789_0496166 Ga0451789_0496166_72_350 91
3544 3300041443 Ga0451789_1326297 Ga0451789_1326297_117_401 91
3545 3300041444 Ga0451790_34245 Ga0451790_34245_419_697 91
3546 3300041445 Ga0451792_22477 Ga0451792_22477_25_300 91
3547 3300041446 Ga0451794_05677 Ga0451794_05677_43_330 91
3548 3300041446 Ga0451794_07771 Ga0451794_07771_35_313 91
3549 3300041451 Ga0451791_1149941 Ga0451791_1149941_1059_1334 91
3550 3300041451 Ga0451791_1657178 Ga0451791_1657178_165_452 91
3551 3300041453 Ga0451797_1510718 Ga0451797_1510718_748_1026 91
3552 3300041453 Ga0451797_1538150 Ga0451797_1538150_454_729 91
3553 3300041454 Ga0451799_33594 Ga0451799_33594_196_474 91
3554 3300041455 Ga0451801_12272 Ga0451801_12272_151_426 91
3555 3300041455 Ga0451801_29483 Ga0451801_29483_415_693 91
3556 3300041456 Ga0451795_0342613 Ga0451795_0342613_187_465 91
3557 3300041456 Ga0451795_1021322 Ga0451795_1021322_139_414 91
3558 3300041457 Ga0451803_13132 Ga0451803_13132_185_463 91
3559 3300041458 Ga0451798_1044063 Ga0451798_1044063_606_884 91
3560 3300041459 Ga0451800_0287125 Ga0451800_0287125_196_474 91
3561 3300041459 Ga0451800_0307366 Ga0451800_0307366_140_424 91
3562 3300041459 Ga0451800_0640459 Ga0451800_0640459_118_396 91
3563 3300041459 Ga0451800_1451982 Ga0451800_1451982_28_315 91
3564 3300041460 Ga0451802_1084816 Ga0451802_1084816_84_362 91
3565 3300041461 Ga0451805_023811 Ga0451805_023811_239_517 91
3566 3300041461 Ga0451805_031316 Ga0451805_031316_206_484 91
3567 3300041463 Ga0451804_0490230 Ga0451804_0490230_34_318 91
3568 3300041463 Ga0451804_0794743 Ga0451804_0794743_335_613 91
3569 3300041463 Ga0451804_1138845 Ga0451804_1138845_900_1178 91
3570 3300041464 Ga0451808_22102 Ga0451808_22102_280_558 91
3571 3300041464 Ga0451808_34934 Ga0451808_34934_1076_1354 91
3572 3300041486 Ga0451807_0782054 Ga0451807_0782054_155_433 91
3573 3300041486 Ga0451807_1140072 Ga0451807_1140072_20_298 91
3574 3300041486 Ga0451807_1146074 Ga0451807_1146074_198_476 91
3575 3300041486 Ga0451807_1466121 Ga0451807_1466121_76_363 91
3576 3300041494 Ga0451837_0263471 Ga0451837_0263471_47_331 91
3577 3300041494 Ga0451837_1328347 Ga0451837_1328347_532_810 91
3578 3300041497 Ga0451840_04070 Ga0451840_04070_239_517 91
3579 3300041498 Ga0451841_1160806 Ga0451841_1160806_440_718 91
3580 3300041502 Ga0451846_15792 Ga0451846_15792_786_1064 91
3581 3300041502 Ga0451846_59778 Ga0451846_59778_388_666 91
3582 3300041503 Ga0451847_0405980 Ga0451847_0405980_14_292 91
3583 3300041506 Ga0451850_11081 Ga0451850_11081_221_496 91
3584 3300041507 Ga0451851_0409079 Ga0451851_0409079_745_1020 91
3585 3300041507 Ga0451851_0574573 Ga0451851_0574573_880_1158 91
3586 3300041509 Ga0451843_0608229 Ga0451843_0608229_1025_1300 91
3587 3300041511 Ga0451855_0587073 Ga0451855_0587073_80_355 91
3588 3300041511 Ga0451855_1747366 Ga0451855_1747366_640_918 91
3589 3300041512 Ga0451853_1032146 Ga0451853_1032146_843_1121 91
3590 3300041907 Ga0452268_14895 Ga0452268_14895_285_563 91
3591 3300041907 Ga0452268_32184 Ga0452268_32184_449_724 91
3592 3300041997 Ga0439431_0058601 Ga0439431_0058601_58_336 91
3593 3300041999 Ga0439433_0040294 Ga0439433_0040294_175_453 91
3594 3300042000 Ga0439437_039603 Ga0439437_039603_79_357 91
3595 3300042002 Ga0439442_001672 Ga0439442_001672_2017_2295 91
3596 3300042004 Ga0439445_0009326 Ga0439445_0009326_1283_1561 91
3597 3300042005 Ga0439448_0012889 Ga0439448_0012889_923_1213 91
3598 3300042006 Ga0439432_010594 Ga0439432_010594_857_1135 91
3599 3300042007 Ga0439449_0034459 Ga0439449_0034459_171_449 91
3600 3300042007 Ga0439449_0315608 Ga0439449_0315608_25_303 91
3601 3300042010 Ga0439452_033713 Ga0439452_033713_301_579 91
3602 3300042011 Ga0439454_050179 Ga0439454_050179_303_581 91
3603 3300042014 Ga0439457_020873 Ga0439457_020873_586_864 91
3604 3300042015 Ga0439462_0036100 Ga0439462_0036100_394_672 91
3605 3300042015 Ga0439462_0042436 Ga0439462_0042436_359_637 91
3606 3300042115 Ga0450911_032112 Ga0450911_032112_256_534 91
3607 3300042121 Ga0450919_011419 Ga0450919_011419_351_629 91
3608 3300042123 Ga0450921_019547 Ga0450921_019547_52_330 91
3609 3300042129 Ga0450891_004918 Ga0450891_004918_433_711 91
3610 3300042132 Ga0450895_017398 Ga0450895_017398_194_472 91
3611 3300042135 Ga0450899_016131 Ga0450899_016131_271_549 91
3612 3300042145 Ga0450906_011336 Ga0450906_011336_1010_1288 91
3613 3300042145 Ga0450906_082296 Ga0450906_082296_136_414 91
3614 3300042146 Ga0450907_091350 Ga0450907_091350_10_288 91
3615 3300042156 Ga0439446_0080445 Ga0439446_0080445_155_433 91
3616 3300042156 Ga0439446_0123676 Ga0439446_0123676_25_303 91
3617 3300042184 Ga0450908_001555 Ga0450908_001555_1654_1932 91
3618 3300042185 Ga0450909_024181 Ga0450909_024181_581_859 91
3619 3300042435 Ga0439434_0013723 Ga0439434_0013723_80_358 91
3620 3300042530 Ga0450916_083310 Ga0450916_083310_181_459 91
3621 3300042532 Ga0450893_0004794 Ga0450893_0004794_1391_1669 91
3622 3300042532 Ga0450893_0113121 Ga0450893_0113121_157_435 91
3623 3300042876 Ga0451577_0027545 Ga0451577_0027545_3936_4214 91
3624 3300042876 Ga0451577_0824511 Ga0451577_0824511_418_693 91
3625 3300044658 Ga0466972_0000416 Ga0466972_0000416_4462_4746 91
3626 3300044712 Ga0453684_0000136 Ga0453684_0000136_320203_320478 91
3627 3300044712 Ga0453684_0303326 Ga0453684_0303326_254_538 91
3628 3300044712 Ga0453684_0851462 Ga0453684_0851462_492_770 91
3629 3300044765 Ga0466970_0000139 Ga0466970_0000139_3540_3824 91
3630 3300044901 Ga0466960_0774625 Ga0466960_0774625_194_472 91
3631 3300045049 Ga0466959_0018867 Ga0466959_0018867_1749_2033 91
3632 3300045051 Ga0451576_0000025 Ga0451576_0000025_107413_107688 91
3633 3300045051 Ga0451576_0106688 Ga0451576_0106688_352_636 91
3634 3300045051 Ga0451576_0239668 Ga0451576_0239668_1234_1518 91
3635 3300045051 Ga0451576_0441307 Ga0451576_0441307_486_764 91
3636 3300045976 Ga0466967_0504737 Ga0466967_0504737_270_554 91
3637 3300046453 Ga0495627_093979 Ga0495627_093979_35_313 91
3638 3300046454 Ga0495592_0607053 Ga0495592_0607053_255_539 91
3639 3300046459 Ga0495629_0817283 Ga0495629_0817283_22_321 91
3640 3300046471 Ga0495650_0114786 Ga0495650_0114786_207_485 91
3641 3300046475 Ga0495639_0060355 Ga0495639_0060355_1028_1306 91
3642 3300046512 Ga0495610_0086172 Ga0495610_0086172_926_1204 91
3643 3300046515 Ga0495620_0388345 Ga0495620_0388345_39_317 91
3644 3300046518 Ga0495631_0000433 Ga0495631_0000433_83_361 91
3645 3300046520 Ga0495637_0003535 Ga0495637_0003535_11_289 91
3646 3300046528 Ga0495642_0022246 Ga0495642_0022246_1545_1823 91
3647 3300046533 Ga0495640_0538805 Ga0495640_0538805_10_294 91
3648 3300046533 Ga0495640_0846716 Ga0495640_0846716_161_445 91
3649 3300046536 Ga0495587_0265940 Ga0495587_0265940_612_896 91
3650 3300046536 Ga0495587_0752514 Ga0495587_0752514_161_439 91
3651 3300046537 Ga0495598_0391762 Ga0495598_0391762_109_387 91
3652 3300046543 Ga0495645_0912251 Ga0495645_0912251_74_352 91
3653 3300046557 Ga0495622_0071199 Ga0495622_0071199_649_933 91
3654 3300046557 Ga0495622_0180746 Ga0495622_0180746_68_346 91
3655 3300046559 Ga0495667_0328194 Ga0495667_0328194_323_607 91
3656 3300046642 Ga0495634_0203741 Ga0495634_0203741_368_652 91
3657 3300046660 Ga0495625_0023820 Ga0495625_0023820_2547_2825 91
3658 3300046660 Ga0495625_0092189 Ga0495625_0092189_1686_1964 91
3659 3300046663 Ga0495635_0346968 Ga0495635_0346968_16_294 91
3660 3300046665 Ga0495661_0095190 Ga0495661_0095190_741_1019 91
3661 3300046674 Ga0495588_0137598 Ga0495588_0137598_592_870 91
3662 3300046674 Ga0495588_0166384 Ga0495588_0166384_631_909 91
3663 3300046680 Ga0495646_0466220 Ga0495646_0466220_85_363 91
3664 3300046683 Ga0495658_0077582 Ga0495658_0077582_726_1004 91
3665 3300046684 Ga0495669_0536246 Ga0495669_0536246_193_471 91
3666 3300046692 Ga0495671_0040313 Ga0495671_0040313_2006_2284 91
3667 3300046809 Ga0495600_0657407 Ga0495600_0657407_75_353 91
3668 3300047321 Ga0495676_0114966 Ga0495676_0114966_906_1184 91
3669 3300047322 Ga0495680_0218621 Ga0495680_0218621_830_1114 91
3670 3300047447 Ga0495685_088348 Ga0495685_088348_640_918 91
3671 3300047472 Ga0495686_0008556 Ga0495686_0008556_5179_5463 91
3672 3300047472 Ga0495686_0584289 Ga0495686_0584289_218_502 91
3673 3300048089 Ga0495614_0033308 Ga0495614_0033308_1650_1928 91
3674 3300048903 Ga0496100_0469822 Ga0496100_0469822_235_513 91
3675 3300048904 Ga0496101_0044571 Ga0496101_0044571_1142_1420 91
3676 3300048904 Ga0496101_0555201 Ga0496101_0555201_298_582 91
3677 3300048905 Ga0496102_0125155 Ga0496102_0125155_467_745 91
3678 3300048906 Ga0496103_0075699 Ga0496103_0075699_1271_1549 91
3679 3300048906 Ga0496103_0734865 Ga0496103_0734865_32_316 91
3680 3300048907 Ga0496104_0731199 Ga0496104_0731199_234_518 91
3681 3300048908 Ga0496105_0016829 Ga0496105_0016829_542_820 91
3682 3300048909 Ga0496106_0069690 Ga0496106_0069690_883_1161 91
3683 3300048910 Ga0496107_0119848 Ga0496107_0119848_617_895 91
3684 3300048910 Ga0496107_0601376 Ga0496107_0601376_171_455 91
3685 3300048911 Ga0496108_1065874 Ga0496108_1065874_370_660 91
3686 3300048912 Ga0496109_0244032 Ga0496109_0244032_511_801 91
3687 3300048912 Ga0496109_0290479 Ga0496109_0290479_798_1076 91
3688 3300048913 Ga0496110_0159326 Ga0496110_0159326_763_1041 91
3689 3300048914 Ga0496111_0074875 Ga0496111_0074875_532_810 91
3690 3300048914 Ga0496111_0634234 Ga0496111_0634234_190_468 91
3691 3300048915 Ga0496112_1164660 Ga0496112_1164660_206_484 91
3692 3300048916 Ga0496113_0159856 Ga0496113_0159856_327_605 91
3693 3300048916 Ga0496113_0658422 Ga0496113_0658422_151_435 91
3694 3300048917 Ga0496114_0022208 Ga0496114_0022208_1521_1805 91
3695 3300048917 Ga0496114_0122348 Ga0496114_0122348_1327_1605 91
3696 3300048918 Ga0496115_0128716 Ga0496115_0128716_802_1086 91
3697 3300048920 Ga0496117_0026828 Ga0496117_0026828_1152_1436 91
3698 3300048920 Ga0496117_0032904 Ga0496117_0032904_832_1116 91
3699 3300048920 Ga0496117_0334504 Ga0496117_0334504_218_493 91
3700 3300048921 Ga0496118_0001647 Ga0496118_0001647_3386_3670 91
3701 3300048921 Ga0496118_0008397 Ga0496118_0008397_2116_2400 91
3702 3300048921 Ga0496118_0015010 Ga0496118_0015010_3001_3279 91
3703 3300048921 Ga0496118_0020758 Ga0496118_0020758_3171_3455 91
3704 3300048922 Ga0496119_0447722 Ga0496119_0447722_306_581 91
3705 3300048923 Ga0496120_0310249 Ga0496120_0310249_149_424 91
3706 3300048924 Ga0496121_0053876 Ga0496121_0053876_1488_1766 91
3707 3300048924 Ga0496121_0128819 Ga0496121_0128819_309_593 91
3708 3300048925 Ga0496122_0001230 Ga0496122_0001230_39629_39913 91
3709 3300048925 Ga0496122_0002564 Ga0496122_0002564_19828_20106 91
3710 3300048925 Ga0496122_0141896 Ga0496122_0141896_304_582 91
3711 3300048926 Ga0496123_0001008 Ga0496123_0001008_3346_3630 91
3712 3300048926 Ga0496123_0002427 Ga0496123_0002427_5423_5701 91
3713 3300048926 Ga0496123_0282827 Ga0496123_0282827_305_580 91
3714 3300048927 Ga0496124_0027342 Ga0496124_0027342_2472_2750 91
3715 3300048927 Ga0496124_0609343 Ga0496124_0609343_299_589 91
3716 3300048928 Ga0496125_0040414 Ga0496125_0040414_3692_3970 91
3717 3300048928 Ga0496125_0042644 Ga0496125_0042644_2233_2523 91
3718 3300048928 Ga0496125_0159139 Ga0496125_0159139_1189_1467 91
3719 3300048928 Ga0496125_0171745 Ga0496125_0171745_459_737 91
3720 3300048928 Ga0496125_0525352 Ga0496125_0525352_75_359 91
3721 3300048929 Ga0496126_0065751 Ga0496126_0065751_1585_1869 91
3722 3300048929 Ga0496126_0190237 Ga0496126_0190237_77_361 91
3723 3300048929 Ga0496126_0213639 Ga0496126_0213639_854_1138 91
3724 3300048929 Ga0496126_1169051 Ga0496126_1169051_92_370 91
3725 3300049127 Ga0501306_000035 Ga0501306_000035_4749_5027 91
3726 3300049127 Ga0501306_009088 Ga0501306_009088_25_303 91
3727 3300049127 Ga0501306_030470 Ga0501306_030470_380_658 91
3728 3300049127 Ga0501306_072145 Ga0501306_072145_193_471 91
3729 3300049128 Ga0501308_001234 Ga0501308_001234_974_1252 91
3730 3300049128 Ga0501308_032326 Ga0501308_032326_308_586 91
3731 3300049129 Ga0501309_073311 Ga0501309_073311_162_440 91
3732 3300049130 Ga0501310_001848 Ga0501310_001848_645_923 91
3733 3300049130 Ga0501310_004685 Ga0501310_004685_995_1270 91
3734 3300049130 Ga0501310_006398 Ga0501310_006398_779_1057 91
3735 3300049130 Ga0501310_011132 Ga0501310_011132_477_755 91
3736 3300049130 Ga0501310_033118 Ga0501310_033118_351_629 91
3737 3300049131 Ga0501341_05765 Ga0501341_05765_188_466 91
3738 3300049132 Ga0501343_026582 Ga0501343_026582_141_419 91
3739 3300049133 Ga0501344_09653 Ga0501344_09653_81_359 91
3740 3300049160 Ga0501304_000125 Ga0501304_000125_691_969 91
3741 3300049161 Ga0501305_000082 Ga0501305_000082_4748_5026 91
3742 3300049161 Ga0501305_013307 Ga0501305_013307_103_381 91
3743 3300049161 Ga0501305_047998 Ga0501305_047998_218_496 91
3744 3300049162 Ga0501307_000021 Ga0501307_000021_4880_5158 91
3745 3300049162 Ga0501307_025836 Ga0501307_025836_352_630 91
3746 3300049162 Ga0501307_041243 Ga0501307_041243_357_635 91
3747 3300049162 Ga0501307_092795 Ga0501307_092795_160_438 91
3748 3300049163 Ga0501342_04660 Ga0501342_04660_124_402 91
3749 3300049515 Ga0501292_097913 Ga0501292_097913_231_509 91
3750 3300049527 Ga0501311_005607 Ga0501311_005607_105_383 91
3751 3300049527 Ga0501311_087864 Ga0501311_087864_104_382 91
3752 3300049528 Ga0501312_000361 Ga0501312_000361_468_746 91
3753 3300049528 Ga0501312_033689 Ga0501312_033689_361_639 91
3754 3300049528 Ga0501312_123766 Ga0501312_123766_135_413 91
3755 3300049529 Ga0501313_063057 Ga0501313_063057_95_373 91
3756 3300049530 Ga0501314_004226 Ga0501314_004226_126_404 91
3757 3300049531 Ga0501315_000043 Ga0501315_000043_296_574 91
3758 3300049531 Ga0501315_000959 Ga0501315_000959_405_683 91
3759 3300049531 Ga0501315_037510 Ga0501315_037510_406_684 91
3760 3300049532 Ga0501316_000017 Ga0501316_000017_4749_5027 91
3761 3300049532 Ga0501316_016799 Ga0501316_016799_519_797 91
3762 3300049532 Ga0501316_076228 Ga0501316_076228_48_326 91
3763 3300049533 Ga0501317_000519 Ga0501317_000519_164_442 91
3764 3300049533 Ga0501317_038428 Ga0501317_038428_110_388 91
3765 3300049534 Ga0501318_004997 Ga0501318_004997_105_383 91
3766 3300049534 Ga0501318_040657 Ga0501318_040657_363_641 91
3767 3300049535 Ga0501319_000067 Ga0501319_000067_110_388 91
3768 3300049535 Ga0501319_001738 Ga0501319_001738_914_1192 91
3769 3300049535 Ga0501319_003880 Ga0501319_003880_189_467 91
3770 3300049536 Ga0501320_002994 Ga0501320_002994_972_1250 91
3771 3300049537 Ga0501321_055097 Ga0501321_055097_104_382 91
3772 3300049537 Ga0501321_055213 Ga0501321_055213_157_435 91
3773 3300049538 Ga0501322_004986 Ga0501322_004986_74_352 91
3774 3300049539 Ga0501323_000130 Ga0501323_000130_2305_2583 91
3775 3300049539 Ga0501323_062191 Ga0501323_062191_86_364 91
3776 3300049539 Ga0501323_076553 Ga0501323_076553_216_494 91
3777 3300049540 Ga0501324_021189 Ga0501324_021189_366_644 91
3778 3300049541 Ga0501325_001699 Ga0501325_001699_71_352 91
3779 3300049541 Ga0501325_002203 Ga0501325_002203_108_386 91
3780 3300049541 Ga0501325_041336 Ga0501325_041336_166_444 91
3781 3300049544 Ga0501328_01513 Ga0501328_01513_117_395 91
3782 3300049545 Ga0501329_00634 Ga0501329_00634_30_308 91
3783 3300049545 Ga0501329_00889 Ga0501329_00889_442_720 91
3784 3300049547 Ga0501331_07642 Ga0501331_07642_62_340 91
3785 3300049547 Ga0501331_11242 Ga0501331_11242_185_463 91
3786 3300049548 Ga0501332_12884 Ga0501332_12884_199_477 91
3787 3300049549 Ga0501333_012765 Ga0501333_012765_222_500 91
3788 3300049550 Ga0501334_12373 Ga0501334_12373_266_544 91
3789 3300049551 Ga0501335_001381 Ga0501335_001381_1081_1359 91
3790 3300049551 Ga0501335_042952 Ga0501335_042952_148_426 91
3791 3300049551 Ga0501335_047668 Ga0501335_047668_145_423 91
3792 3300049552 Ga0501336_000323 Ga0501336_000323_911_1189 91
3793 3300049552 Ga0501336_002665 Ga0501336_002665_631_909 91
3794 3300049552 Ga0501336_003652 Ga0501336_003652_63_341 91
3795 3300049554 Ga0501338_01526 Ga0501338_01526_793_1071 91
3796 3300049554 Ga0501338_05891 Ga0501338_05891_152_430 91
3797 3300049556 Ga0501340_000361 Ga0501340_000361_1349_1627 91
3798 3300049556 Ga0501340_009600 Ga0501340_009600_105_383 91
3799 3300049568 Ga0501031_0047206 Ga0501031_0047206_637_921 91
3800 3300049568 Ga0501031_0908691 Ga0501031_0908691_193_477 91
3801 3300049569 Ga0501032_0020602 Ga0501032_0020602_1144_1428 91
3802 3300049569 Ga0501032_0045411 Ga0501032_0045411_16_300 91
3803 3300049570 Ga0501033_0000337 Ga0501033_0000337_3164_3448 91
3804 3300049571 Ga0501034_0025504 Ga0501034_0025504_3152_3436 91
3805 3300049571 Ga0501034_0056333 Ga0501034_0056333_742_1026 91
3806 3300049571 Ga0501034_0066470 Ga0501034_0066470_357_641 91
3807 3300049571 Ga0501034_0075626 Ga0501034_0075626_2149_2427 91
3808 3300049572 Ga0501036_0030355 Ga0501036_0030355_2396_2680 91
3809 3300049572 Ga0501036_0037846 Ga0501036_0037846_673_957 91
3810 3300049572 Ga0501036_1172272 Ga0501036_1172272_16_300 91
3811 3300049573 Ga0501037_0066649 Ga0501037_0066649_1960_2244 91
3812 3300049573 Ga0501037_0070227 Ga0501037_0070227_942_1226 91
3813 3300049573 Ga0501037_0119741 Ga0501037_0119741_953_1237 91
3814 3300049573 Ga0501037_0837925 Ga0501037_0837925_242_526 91
3815 3300049574 Ga0501038_0091007 Ga0501038_0091007_1747_2031 91
3816 3300049574 Ga0501038_0163124 Ga0501038_0163124_1252_1536 91
3817 3300049574 Ga0501038_0185128 Ga0501038_0185128_840_1124 91
3818 3300049575 Ga0501039_0036074 Ga0501039_0036074_46_330 91
3819 3300049575 Ga0501039_0079649 Ga0501039_0079649_942_1226 91
3820 3300049575 Ga0501039_0461883 Ga0501039_0461883_629_913 91
3821 3300049576 Ga0501040_0101178 Ga0501040_0101178_1003_1287 91
3822 3300049578 Ga0501042_0049962 Ga0501042_0049962_1516_1800 91
3823 3300049579 Ga0501043_0136461 Ga0501043_0136461_953_1237 91
3824 3300049579 Ga0501043_0363339 Ga0501043_0363339_588_872 91
3825 3300049579 Ga0501043_0535642 Ga0501043_0535642_555_839 91
3826 3300049580 Ga0501046_0025093 Ga0501046_0025093_4533_4817 91
3827 3300049580 Ga0501046_0103560 Ga0501046_0103560_956_1240 91
3828 3300049580 Ga0501046_0403200 Ga0501046_0403200_147_431 91
3829 3300049581 Ga0501047_0000250 Ga0501047_0000250_2912_3196 91
3830 3300049581 Ga0501047_0286485 Ga0501047_0286485_643_933 91
3831 3300049581 Ga0501047_1233665 Ga0501047_1233665_104_388 91
3832 3300049581 Ga0501047_1387500 Ga0501047_1387500_62_346 91
3833 3300049582 Ga0501048_0029557 Ga0501048_0029557_922_1206 91
3834 3300049583 Ga0501067_0015294 Ga0501067_0015294_1082_1366 91
3835 3300049583 Ga0501067_0019365 Ga0501067_0019365_2979_3263 91
3836 3300049583 Ga0501067_0174193 Ga0501067_0174193_760_1044 91
3837 3300049584 Ga0501068_0054791 Ga0501068_0054791_774_1058 91
3838 3300049584 Ga0501068_0260816 Ga0501068_0260816_751_1035 91
3839 3300049584 Ga0501068_0582825 Ga0501068_0582825_203_487 91
3840 3300049585 Ga0501069_0009337 Ga0501069_0009337_4756_5049 91
3841 3300049585 Ga0501069_0022029 Ga0501069_0022029_590_874 91
3842 3300049585 Ga0501069_0036066 Ga0501069_0036066_1887_2171 91
3843 3300049585 Ga0501069_0289542 Ga0501069_0289542_518_802 91
3844 3300049585 Ga0501069_0386053 Ga0501069_0386053_446_724 91
3845 3300049585 Ga0501069_0872022 Ga0501069_0872022_199_483 91
3846 3300049586 Ga0501070_0033540 Ga0501070_0033540_3245_3538 91
3847 3300049586 Ga0501070_0033585 Ga0501070_0033585_1137_1421 91
3848 3300049586 Ga0501070_0042967 Ga0501070_0042967_500_784 91
3849 3300049586 Ga0501070_0159631 Ga0501070_0159631_995_1297 91
3850 3300049586 Ga0501070_0261210 Ga0501070_0261210_158_451 91
3851 3300049586 Ga0501070_0783878 Ga0501070_0783878_55_339 91
3852 3300049587 Ga0501071_1106111 Ga0501071_1106111_237_521 91
3853 3300049588 Ga0501072_0021878 Ga0501072_0021878_1699_1983 91
3854 3300049588 Ga0501072_0097845 Ga0501072_0097845_1114_1398 91
3855 3300049589 Ga0501073_0000196 Ga0501073_0000196_36771_37055 91
3856 3300049589 Ga0501073_0143881 Ga0501073_0143881_16_300 91
3857 3300049589 Ga0501073_0253984 Ga0501073_0253984_188_472 91
3858 3300049589 Ga0501073_0328643 Ga0501073_0328643_26_316 91
3859 3300049589 Ga0501073_0553918 Ga0501073_0553918_299_583 91
3860 3300049590 Ga0501074_0023356 Ga0501074_0023356_942_1226 91
3861 3300049590 Ga0501074_0028113 Ga0501074_0028113_516_896 91
3862 3300049590 Ga0501074_0031616 Ga0501074_0031616_2833_3117 91
3863 3300049590 Ga0501074_0037471 Ga0501074_0037471_2883_3167 91
3864 3300049590 Ga0501074_0404991 Ga0501074_0404991_298_582 91
3865 3300049592 Ga0501076_0042220 Ga0501076_0042220_1659_1943 91
3866 3300049593 Ga0501077_0528580 Ga0501077_0528580_163_447 91
3867 3300049652 Ga0501202_155020 Ga0501202_155020_166_444 91
3868 3300049671 Ga0501238_083471 Ga0501238_083471_211_489 91
3869 3300049686 Ga0501257_096202 Ga0501257_096202_18_296 91
3870 3300049705 Ga0501225_0037836 Ga0501225_0037836_302_580 91
3871 3300049705 Ga0501225_0100543 Ga0501225_0100543_325_603 91
3872 3300049741 Ga0501079_0174269 Ga0501079_0174269_1011_1295 91
3873 3300049741 Ga0501079_0443597 Ga0501079_0443597_318_608 91
3874 3300049741 Ga0501079_0781760 Ga0501079_0781760_283_567 91
3875 3300049742 Ga0501080_0005488 Ga0501080_0005488_2979_3263 91
3876 3300049742 Ga0501080_0021132 Ga0501080_0021132_595_879 91
3877 3300049742 Ga0501080_0045089 Ga0501080_0045089_683_967 91
3878 3300049742 Ga0501080_0049719 Ga0501080_0049719_3064_3348 91
3879 3300049742 Ga0501080_0125203 Ga0501080_0125203_1540_1824 91
3880 3300049743 Ga0501081_0223592 Ga0501081_0223592_32_316 91
3881 3300049744 Ga0501083_0021386 Ga0501083_0021386_2978_3262 91
3882 3300049744 Ga0501083_0035514 Ga0501083_0035514_2958_3242 91
3883 3300049744 Ga0501083_1013307 Ga0501083_1013307_141_425 91
3884 3300049759 Ga0501262_000066 Ga0501262_000066_4790_5068 91
3885 3300049822 Ga0501035_0123668 Ga0501035_0123668_834_1118 91
3886 3300049822 Ga0501035_0431671 Ga0501035_0431671_232_516 91
3887 3300049822 Ga0501035_0454260 Ga0501035_0454260_234_518 91
3888 3300049823 Ga0501044_0129150 Ga0501044_0129150_464_748 91
3889 3300049823 Ga0501044_0147413 Ga0501044_0147413_555_839 91
3890 3300049823 Ga0501044_0148736 Ga0501044_0148736_898_1182 91
3891 3300049823 Ga0501044_0220026 Ga0501044_0220026_613_897 91
3892 3300049823 Ga0501044_0268833 Ga0501044_0268833_479_763 91
3893 3300049823 Ga0501044_0341586 Ga0501044_0341586_928_1212 91
3894 3300049823 Ga0501044_0501840 Ga0501044_0501840_717_1001 91
3895 3300049823 Ga0501044_1127400 Ga0501044_1127400_148_423 91
3896 3300049824 Ga0501045_0042206 Ga0501045_0042206_1141_1425 91
3897 3300049824 Ga0501045_0623554 Ga0501045_0623554_463_747 91
3898 3300049853 Ga0501226_014778 Ga0501226_014778_152_430 91
3899 3300050489 nmdc:mga03683_119959_c1 nmdc:mga03683_119959_c1_876_1154 91
3900 3300050489 nmdc:mga03683_187770_c1 nmdc:mga03683_187770_c1_302_580 91
3901 3300050489 nmdc:mga03683_72383_c1 nmdc:mga03683_72383_c1_967_1245 91
3902 3300050490 nmdc:mga03n38_105928_c1 nmdc:mga03n38_105928_c1_688_966 91
3903 3300050490 nmdc:mga03n38_267255_c1 nmdc:mga03n38_267255_c1_533_811 91
3904 3300050491 nmdc:mga00v17_26417_c1 nmdc:mga00v17_26417_c1_499_777 91
3905 3300050491 nmdc:mga00v17_59069_c2 nmdc:mga00v17_59069_c2_74_352 91
3906 3300050491 nmdc:mga00v17_715126_c1 nmdc:mga00v17_715126_c1_332_631 91
3907 3300050491 nmdc:mga00v17_87217_c1 nmdc:mga00v17_87217_c1_705_1007 91
3908 3300050492 nmdc:mga0yw44_173980_c1 nmdc:mga0yw44_173980_c1_435_713 91
3909 3300050492 nmdc:mga0yw44_631391_c1 nmdc:mga0yw44_631391_c1_409_687 91
3910 3300050493 nmdc:mga0k408_172217_c1 nmdc:mga0k408_172217_c1_368_646 91
3911 3300050493 nmdc:mga0k408_571442_c1 nmdc:mga0k408_571442_c1_39_317 91
3912 3300050493 nmdc:mga0k408_72253_c1 nmdc:mga0k408_72253_c1_1699_1977 91
3913 3300050495 nmdc:mga04h51_37470_c1 nmdc:mga04h51_37470_c1_1210_1512 91
3914 3300050496 nmdc:mga07m45_124840_c2 nmdc:mga07m45_124840_c2_616_900 91
3915 3300050496 nmdc:mga07m45_273534_c1 nmdc:mga07m45_273534_c1_326_604 91
3916 3300050496 nmdc:mga07m45_47114_c1 nmdc:mga07m45_47114_c1_2129_2407 91
3917 3300050496 nmdc:mga07m45_65139_c1 nmdc:mga07m45_65139_c1_497_775 91
3918 3300050514 nmdc:mga08x19_1005121_c1 nmdc:mga08x19_1005121_c1_249_527 91
3919 3300050516 nmdc:mga0sz30_239801_c1 nmdc:mga0sz30_239801_c1_411_689 91
3920 3300050516 nmdc:mga0sz30_85457_c1 nmdc:mga0sz30_85457_c1_1043_1321 91
3921 3300053079 Ga0500610_0134209 Ga0500610_0134209_577_855 91
3922 3300053080 Ga0500635_0190763 Ga0500635_0190763_191_475 91
3923 3300053087 Ga0500643_001959 Ga0500643_001959_9468_9752 91
3924 3300053087 Ga0500643_034713 Ga0500643_034713_260_538 91
3925 3300053087 Ga0500643_073982 Ga0500643_073982_624_902 91
3926 3300053088 Ga0500644_0114733 Ga0500644_0114733_544_822 91
3927 3300053092 Ga0500583_0373379 Ga0500583_0373379_84_368 91
3928 3300053093 Ga0500651_0000076 Ga0500651_0000076_57331_57609 91
3929 3300053094 Ga0500566_0491514 Ga0500566_0491514_164_442 91
3930 3300053103 Ga0500555_087885 Ga0500555_087885_86_364 91
3931 3300053108 Ga0500562_074497 Ga0500562_074497_528_806 91
3932 3300053110 Ga0500571_068468 Ga0500571_068468_776_1054 91
3933 3300053117 Ga0500593_167349 Ga0500593_167349_466_744 91
3934 3300053118 Ga0500594_0014129 Ga0500594_0014129_741_1019 91
3935 3300053118 Ga0500594_0336939 Ga0500594_0336939_166_444 91
3936 3300053120 Ga0500597_006025 Ga0500597_006025_2786_3070 91
3937 3300053121 Ga0500607_037256 Ga0500607_037256_2140_2418 91
3938 3300053125 Ga0500618_090336 Ga0500618_090336_240_518 91
3939 3300053133 Ga0500655_010077 Ga0500655_010077_120_398 91
3940 3300053134 Ga0500658_0000913 Ga0500658_0000913_5367_5645 91
3941 3300053134 Ga0500658_0265708 Ga0500658_0265708_345_623 91
3942 3300053136 Ga0500559_0017155 Ga0500559_0017155_2535_2819 91
3943 3300053136 Ga0500559_0083948 Ga0500559_0083948_492_770 91
3944 3300053136 Ga0500559_0502818 Ga0500559_0502818_161_439 91
3945 3300053138 Ga0500564_337665 Ga0500564_337665_248_532 91
3946 3300053139 Ga0500568_0005392 Ga0500568_0005392_4332_4610 91
3947 3300053142 Ga0500577_0171394 Ga0500577_0171394_17_295 91
3948 3300053153 Ga0500616_0013427 Ga0500616_0013427_1261_1539 91
3949 3300053153 Ga0500616_0427653 Ga0500616_0427653_166_444 91
3950 3300053161 Ga0500634_0017209 Ga0500634_0017209_1685_1963 91
3951 3300053161 Ga0500634_0233380 Ga0500634_0233380_30_305 91
3952 3300053177 Ga0500636_0464911 Ga0500636_0464911_170_448 91
3953 3300054114 Ga0501084_0218263 Ga0501084_0218263_1208_1492 91
3954 3300054114 Ga0501084_0786601 Ga0501084_0786601_32_316 91
3955 3300055283 Ga0500661_013666 Ga0500661_013666_160_444 91
3956 3300055283 Ga0500661_024258 Ga0500661_024258_554_832 91
3957 3300059477 Ga0587084_001228 Ga0587084_001228_2087_2365 91
3958 3300059478 Ga0587093_008173 Ga0587093_008173_807_1085 91
3959 3300059490 Ga0587066_071241 Ga0587066_071241_111_389 91
3960 3300059491 Ga0587070_130338 Ga0587070_130338_150_434 91
3961 3300059493 Ga0587077_017106 Ga0587077_017106_121_399 91
3962 3300059493 Ga0587077_024321 Ga0587077_024321_10_294 91
3963 3300059493 Ga0587077_065398 Ga0587077_065398_503_781 91
3964 3300059493 Ga0587077_109869 Ga0587077_109869_235_513 91
3965 3300059503 Ga0587080_050191 Ga0587080_050191_123_407 91
3966 3300059505 Ga0587083_0002339 Ga0587083_0002339_1717_1995 91
3967 3300059505 Ga0587083_0016520 Ga0587083_0016520_903_1181 91
3968 3300059506 Ga0587085_063822 Ga0587085_063822_281_559 91
3969 3300059508 Ga0587088_047669 Ga0587088_047669_199_477 91
3970 3300059509 Ga0587089_078718 Ga0587089_078718_185_463 91
3971 3300059510 Ga0587090_000294 Ga0587090_000294_2578_2856 91
3972 3300059510 Ga0587090_062157 Ga0587090_062157_13_291 91
3973 3300059510 Ga0587090_062158 Ga0587090_062158_13_291 91
3974 3300059511 Ga0587091_010383 Ga0587091_010383_985_1263 91
3975 3300059512 Ga0587092_009534 Ga0587092_009534_922_1200 91
3976 3300059513 Ga0587094_003374 Ga0587094_003374_928_1206 91
3977 3300059604 Ga0587098_000913 Ga0587098_000913_962_1240 91
3978 3300059605 Ga0587106_000773 Ga0587106_000773_102_380 91
3979 3300059605 Ga0587106_088196 Ga0587106_088196_130_408 91
3980 3300059623 Ga0587101_066537 Ga0587101_066537_292_570 91
3981 3300059624 Ga0587109_019045 Ga0587109_019045_36_314 91
3982 3300059624 Ga0587109_194549 Ga0587109_194549_126_404 91
3983 3300059627 Ga0587117_082114 Ga0587117_082114_182_460 91
3984 3300059627 Ga0587117_083248 Ga0587117_083248_119_397 91
3985 3300059630 Ga0587128_015846 Ga0587128_015846_270_548 91
3986 3300059630 Ga0587128_163839 Ga0587128_163839_130_414 91
3987 3300059639 Ga0587062_006615 Ga0587062_006615_134_412 91
3988 3300059640 Ga0587067_011719 Ga0587067_011719_220_498 91
3989 3300059641 Ga0587068_023959 Ga0587068_023959_91_369 91
3990 3300059641 Ga0587068_087023 Ga0587068_087023_64_342 91
3991 3300059642 Ga0587069_135855 Ga0587069_135855_136_414 91
3992 3300059643 Ga0587072_001029 Ga0587072_001029_2220_2498 91
3993 3300059643 Ga0587072_177743 Ga0587072_177743_144_422 91
3994 3300059645 Ga0587076_019376 Ga0587076_019376_637_915 91
3995 3300059645 Ga0587076_031592 Ga0587076_031592_625_900 91
3996 3300059645 Ga0587076_068994 Ga0587076_068994_104_388 91
3997 3300059645 Ga0587076_159517 Ga0587076_159517_89_367 91
3998 3300059645 Ga0587076_162336 Ga0587076_162336_174_452 91
3999 3300059646 Ga0587078_032781 Ga0587078_032781_321_599 91
4000 3300059647 Ga0587079_019498 Ga0587079_019498_75_353 91
4001 3300059647 Ga0587079_080501 Ga0587079_080501_377_661 91
4002 3300059648 Ga0587100_015560 Ga0587100_015560_121_399 91
4003 3300059651 Ga0587105_000202 Ga0587105_000202_993_1271 91
4004 3300059653 Ga0587108_001563 Ga0587108_001563_113_391 91
4005 3300059657 Ga0587118_03174 Ga0587118_03174_569_847 91
4006 3300059658 Ga0587119_079894 Ga0587119_079894_142_420 91
4007 3300059660 Ga0587124_047643 Ga0587124_047643_25_303 91
4008 3300059660 Ga0587124_048182 Ga0587124_048182_45_323 91
4009 3300060344 Ga0587071_013628 Ga0587071_013628_216_494 91
4010 3300060346 Ga0587111_0004434 Ga0587111_0004434_972_1250 91
4011 3300060353 Ga0501082_0017750 Ga0501082_0017750_2921_3205 91
4012 3300060353 Ga0501082_0521805 Ga0501082_0521805_653_937 91
4013 3300060353 Ga0501082_0573216 Ga0501082_0573216_117_401 91
4014 3300061734 Ga0530510_0163863 Ga0530510_0163863_153_437 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00203

Ribosomal_S19

Ribosomal protein S19

3

83

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_BS real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.9476 12 74
7qv3-assembly1.cif.gz_s bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.9311 4 79
6ha8-assembly1.cif.gz_s cryo-em structure of the abcf protein vmlr bound to the bacillus subtilis ribosome 0.9276 4 80
7pjs-assembly1.cif.gz_s structure of the 70s ribosome with trnas in the classical pre-translocation state and apramycin (c) 0.9246 2 82
5mmm-assembly1.cif.gz_s structure of the 70s chloroplast ribosome 0.9225 8 82
ID Description Score Start End Superfamily
4kj2S00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.9012 3 80 3.30.860.10
5zeus00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.887 7 82 3.30.860.10
af_P06588_1_92_3.30.860.10 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8824 8 87 3.30.860.10
4tpaS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8824 3 80 3.30.860.10
2qouS00 Alpha Beta;2-Layer Sandwich;30s Ribosomal Protein S19; Chain A;Ribosomal protein S19/S15 0.8823 3 80 3.30.860.10
ID Description Score Start End GO Terms
AF-A0A496S2X8-F1-model_v4 Small ribosomal subunit protein uS19 0.9284 1 82 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A5N8YY27-F1-model_v4 Small ribosomal subunit protein uS19 0.9257 1 82 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1W9SCD7-F1-model_v4 Small ribosomal subunit protein uS19 0.9253 1 82 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1F4D0M7-F1-model_v4 Small ribosomal subunit protein uS19 0.9237 1 82 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A2H0XB14-F1-model_v4 Small ribosomal subunit protein uS19 0.9214 1 82 GO:0000028
GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843

Feature Viewer

pLDDT pTM Quality
88.1 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map