F497429

General Info

Members Datasets Scaffolds Average Seq Length
4174 1391 8348 730

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2687453341|2688391182
Length 832
Sequence TANLRMKSGKKLSTPRVRRRRLSVLRSLLWGTLAIGSASLSGTVILAQSHDSPVPAAAAPHVGGPGVGHGAGHGAAGGKCPVTGAFQSFAALAKSVQQDDSGIEGTVGSMSNGDWWPDQLNLKILHQNSPMGNPMGESFNYAEEFKKLDLAAVKKDIAALMTQSQDWWPADYGHYGPLFIRMAWHSAGTYRVQDGRGGAGYGTQRFAPLNSWPDNANLDKARRLLWPIKQKYGKRISWADLMVLTGNVALESMGFKTFGFAGGRADVWEPQEDIYWGPESEWLGDKRYTGDRDLENPLAAVQMGLIYVNPEGPNGKPDPIAAARDIRETFARMAMNDEETVALIAGGHTFGKAHGAASPEGNVGPEPEGASIEEQGLGWKNKLGKGNAGDTITSGLEGAWTTTPTEWSNGYFENLFGYEWELTKSPAGAAQWKPKGDAGKGTVPDAHDPKKSHAPIMFTTDLALRMDPIYAKISKRFHDNPKEFELAFAKAWYKLTHRDMGPVARCLGPEVPEPQIWQDPIPAVDHELVGEQDIASLKSQIVKSGLPISQLVATAWASASTFRGTDKRGGANGGRIRLQPQKDWAVNEPAELKTTLTVLEKIQKEFNGAQRGGKKISMADLIVLAGCAGVEEAAKRAGTPVQVPFEPGRADTTQELTDTASFKPLEPTVDGFRNYKHPKHKRPAEQYLVDRAHMLTLSAPEMTALVGGLRVLGANTGNTKLGVFTEKPETLTNDFFVHLLDQETEWKKSGDSEEVFEGKDRKSGKVKWTGTRVDLVFGSNSQLRAISEVYASGDGKEKFVKDFVAAWNKVMHLDRFDLDPSLRQAAKKVASN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
29 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
33 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
34 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
37 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
38 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
42 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
43 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
54 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
55 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
56 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
57 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
58 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
59 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
60 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
70 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
71 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
72 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
86 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
89 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
90 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
91 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
98 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
99 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
100 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
101 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
102 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
103 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
104 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
107 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
108 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
109 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
110 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
113 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
114 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
115 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
116 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
117 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
118 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
125 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
126 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
127 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
128 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
129 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
130 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
131 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
132 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
133 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
135 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
136 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
137 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
138 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
139 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
140 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
141 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
142 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
143 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
144 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
145 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
146 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
147 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
149 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
150 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
151 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
152 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
153 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
154 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
155 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
156 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
157 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
160 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
161 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
162 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
163 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
164 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
165 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
166 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
167 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
168 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
169 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
170 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
171 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
172 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
173 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
174 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
175 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
176 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
177 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
178 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
179 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
180 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
181 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
182 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
183 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
184 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
185 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
186 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
187 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
188 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
189 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
190 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
191 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
192 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
193 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
194 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
195 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
196 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
197 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
198 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
199 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
200 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
201 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
202 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
203 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
204 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
205 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
207 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
208 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
209 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
211 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
212 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
213 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
214 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
215 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
216 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
217 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
218 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
219 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
220 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
221 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
222 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
228 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
229 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
231 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
232 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
233 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
236 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
237 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
238 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
239 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
243 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
246 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
248 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
250 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
251 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
322 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
323 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
325 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
327 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
329 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
333 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
334 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
335 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
336 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
337 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
338 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
339 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
340 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
341 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
342 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
343 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
344 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
345 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
346 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
347 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
348 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
349 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
350 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
351 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
354 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
355 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
356 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
357 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
358 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
359 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
360 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
361 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
362 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
363 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
364 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
365 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
366 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
367 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
368 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
369 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
370 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
371 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
372 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
373 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
374 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
375 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
376 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
377 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
378 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
379 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
380 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
381 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
382 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
383 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
384 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
385 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
386 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
387 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
388 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
389 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
390 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
391 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
392 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
393 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
394 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
396 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
397 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
402 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
403 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
404 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
405 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
406 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
407 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
408 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
409 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
410 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
411 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
412 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
413 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
414 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
415 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
416 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
417 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
418 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
419 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
420 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
421 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
422 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
423 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
424 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
425 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
426 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
427 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
428 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
429 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
430 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
431 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
432 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
433 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
434 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
435 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
436 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
437 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
438 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
439 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
440 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
441 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
442 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
443 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
444 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
445 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
446 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
447 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
448 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
449 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
450 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
451 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
452 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
453 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
454 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
455 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
456 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
457 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
458 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
459 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
460 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
461 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
462 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
463 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
464 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
465 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
466 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
467 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
468 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
469 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
470 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
471 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
472 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
473 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
474 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
475 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
476 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
477 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
478 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
479 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
480 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
481 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
482 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
483 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
484 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
485 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
486 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
487 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
488 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
489 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
490 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
491 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
492 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
493 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
494 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
495 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
496 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
497 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
498 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
499 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
500 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
501 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
502 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
503 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
504 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
505 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
506 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
507 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
508 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
509 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
510 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
511 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
512 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
513 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
514 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
515 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
516 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
517 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
518 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
519 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
520 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
521 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
522 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
523 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
524 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
525 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
526 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
527 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
528 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
529 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
530 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
531 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
532 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
533 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
534 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
535 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
536 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
537 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
538 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
539 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
540 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
541 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
542 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
543 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
544 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
545 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
546 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
547 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
548 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
549 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
550 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
551 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
552 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
553 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
554 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
555 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
556 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
557 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
558 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
559 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
560 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
561 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
562 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
563 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
564 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
565 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
566 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
567 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
568 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
569 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
570 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
571 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
572 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
573 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
574 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
575 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
576 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
577 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
578 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
579 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
580 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
581 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
582 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
583 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
584 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
585 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
586 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
587 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
588 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
589 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
590 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
591 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
592 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
593 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
594 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
595 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
596 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
597 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
598 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
599 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
600 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
601 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
602 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
603 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
604 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
605 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
606 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
607 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
608 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
609 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
610 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
611 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
612 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
613 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
614 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
615 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
616 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
617 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
618 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
619 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
620 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
621 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
622 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
623 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
624 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
625 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
626 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
627 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
628 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
629 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
630 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
631 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
632 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
633 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
634 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
635 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
636 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
637 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
638 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
639 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
640 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
641 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
642 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
643 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
644 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
645 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
646 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
647 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
648 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
649 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
650 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
651 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
652 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
653 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
654 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
655 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
656 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
657 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
658 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
659 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
660 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
661 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
662 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
663 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
664 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
665 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
666 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
667 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
668 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
669 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
670 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
671 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
672 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
673 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
674 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
675 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
676 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
677 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
678 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
679 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
680 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
681 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
682 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
683 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
684 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
685 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
686 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
687 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
688 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
689 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
690 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
691 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
692 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
693 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
694 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
695 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
696 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
697 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
698 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
699 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
700 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
701 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
702 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
703 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
704 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
705 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
706 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
707 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
708 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
709 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
710 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
711 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
712 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
713 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
714 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
715 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
716 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
717 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
718 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
719 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
720 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
721 2506783011 Frankia datiscae Dg1 Isolate Nodule
722 2508501050 Microvirga lupini Lut6 Isolate Nodule
723 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
724 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
725 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
726 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
727 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
728 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
729 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
730 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
731 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
732 2511231006 Pseudomonas sp. GM17 Isolate Nodule
733 2511231007 Pseudomonas sp. GM18 Isolate Nodule
734 2511231010 Pseudomonas sp. GM25 Isolate Nodule
735 2511231011 Pseudomonas sp. GM30 Isolate Nodule
736 2511231014 Pseudomonas sp. GM48 Isolate Nodule
737 2511231023 Pseudomonas sp. GM80 Isolate Nodule
738 2511231024 Pseudomonas sp. GM84 Isolate Nodule
739 2511231031 Pseudomonas sp. GM16 Isolate Nodule
740 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
741 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
742 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
743 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
744 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
745 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
746 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
747 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
748 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
749 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
750 2516143018 Ensifer sp. BR816 Isolate Nodule
751 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
752 2517572101 Frankia sp. DC12 Isolate Nodule
753 2519103095 Burkholderia sp. KJ006 Isolate Nodule
754 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
755 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
756 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
757 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
758 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
759 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
760 2527291627 Frankia casuarinae Thr Isolate Nodule
761 2527291629 Frankia sp. BMG5.23 Isolate Nodule
762 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
763 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
764 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
765 2547132374 Acidovorax radicis N35 Isolate Unclassified
766 2547132424 Nocardia nova SH22a Isolate Unclassified
767 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
768 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
769 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
770 2558860280 Kutzneria sp. 744 Isolate Unclassified
771 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
772 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
773 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
774 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
775 2576861822 Frankia sp. CeD Isolate Nodule
776 2582580736 Prauserella sp. Am3 Isolate Unclassified
777 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
778 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
779 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
780 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
781 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
782 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
783 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
784 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
785 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
786 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
787 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
788 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
789 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
790 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
791 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
792 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
793 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
794 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
795 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
796 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
797 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
798 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
799 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
800 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
801 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
802 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
803 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
804 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
805 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
806 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
807 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
808 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
809 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
810 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
811 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
812 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
813 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
814 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
815 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
816 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
817 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
818 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
819 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
820 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
821 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
822 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
823 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
824 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
825 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
826 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
827 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
828 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
829 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
830 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
831 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
832 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
833 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
834 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
835 2643221548 Streptomyces sp. Root55 Isolate Unclassified
836 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
837 2643221557 Ensifer sp. Root558 Isolate Unclassified
838 2643221559 Lysobacter sp. Root559 Isolate Unclassified
839 2643221561 Nocardioides sp. Root151 Isolate Unclassified
840 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
841 2643221573 Lysobacter sp. Root604 Isolate Unclassified
842 2643221575 Microbacterium sp. Root61 Isolate Unclassified
843 2643221576 Nocardioides sp. Root614 Isolate Unclassified
844 2643221578 Streptomyces sp. Root63 Isolate Unclassified
845 2643221585 Pelomonas sp. Root662 Isolate Unclassified
846 2643221586 Lysobacter sp. Root667 Isolate Unclassified
847 2643221590 Nocardioides sp. Root682 Isolate Unclassified
848 2643221593 Lysobacter sp. Root690 Isolate Unclassified
849 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
850 2643221599 Rhizobium sp. Root708 Isolate Unclassified
851 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
852 2643221604 Nocardioides sp. Root190 Isolate Unclassified
853 2643221607 Rhizobium sp. Root73 Isolate Unclassified
854 2643221609 Acidovorax sp. Root217 Isolate Unclassified
855 2643221610 Ensifer sp. Root74 Isolate Unclassified
856 2643221612 Lysobacter sp. Root76 Isolate Unclassified
857 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
858 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
859 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
860 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
861 2643221629 Devosia sp. Root105 Isolate Unclassified
862 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
863 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
864 2643221638 Duganella sp. Root336D2 Isolate Unclassified
865 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
866 2643221647 Streptomyces sp. Root369 Isolate Unclassified
867 2643221656 Pelomonas sp. Root405 Isolate Unclassified
868 2643221662 Devosia sp. Root413D1 Isolate Unclassified
869 2643221668 Ensifer sp. Root423 Isolate Unclassified
870 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
871 2643221675 Ensifer sp. Root1298 Isolate Unclassified
872 2643221679 Angustibacter sp. Root456 Isolate Unclassified
873 2643221680 Ensifer sp. Root1312 Isolate Unclassified
874 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
875 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
876 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
877 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
878 2643221692 Nocardia sp. Root136 Isolate Unclassified
879 2643221696 Nocardioides sp. Root140 Isolate Unclassified
880 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
881 2643221711 Terrabacter sp. Root85 Isolate Unclassified
882 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
883 2643221717 Acidovorax sp. Root267 Isolate Unclassified
884 2643221718 Rhizobium sp. Root268 Isolate Unclassified
885 2643221720 Lysobacter sp. Root916 Isolate Unclassified
886 2643221723 Ensifer sp. Root278 Isolate Unclassified
887 2643221726 Ensifer sp. Root954 Isolate Unclassified
888 2643221727 Lysobacter sp. Root96 Isolate Unclassified
889 2643221728 Lysobacter sp. Root983 Isolate Unclassified
890 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
891 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
892 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
893 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
894 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
895 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
896 2684623036 Frankia sp. CgIM4 Isolate Nodule
897 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
898 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
899 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
900 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
901 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
902 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
903 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
904 2710264753 Frankia sp. KB5 Isolate Nodule
905 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
906 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
907 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
908 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
909 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
910 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
911 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
912 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
913 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
914 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
915 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
916 2738541277 Variovorax sp. GV051 Isolate Unclassified
917 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
918 2738541297 Duganella sp. GV083 Isolate Unclassified
919 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
920 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
921 2738541307 Variovorax sp. GV008 Isolate Unclassified
922 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
923 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
924 2738541357 Duganella sp. GV053 Isolate Unclassified
925 2738543003 Duganella sp. GV066 Isolate Unclassified
926 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
927 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
928 2738543019 Variovorax sp. GV040 Isolate Unclassified
929 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
930 2738543024 Aminobacter sp. AP02 Isolate Unclassified
931 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
932 2738543026 Duganella sp. GV089 Isolate Unclassified
933 2738543029 Duganella sp. GV039 Isolate Unclassified
934 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
935 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
936 2739367898 Nocardioides sp. CF479 Isolate Unclassified
937 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
938 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
939 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
940 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
941 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
942 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
943 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
944 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
945 2765235841 Pseudomonas putida AA7 Isolate Unclassified
946 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
947 2773857673 Pseudomonas sp. 443 Isolate Unclassified
948 2773857924 Frankia sp. CgIS1 Isolate Nodule
949 2773857925 Microvirga vignae BR3299 Isolate Unclassified
950 2773857933 Frankia sp. BMG5.30 Isolate Nodule
951 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
952 2784132063 Pseudomonas sp. 424 Isolate Unclassified
953 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
954 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
955 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
956 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
957 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
958 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
959 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
960 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
961 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
962 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
963 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
964 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
965 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
966 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
967 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
968 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
969 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
970 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
971 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
972 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
973 2808606448 Streptomyces sp. 193411 Isolate Unclassified
974 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
975 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
976 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
977 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
978 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
979 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
980 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
981 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
982 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
983 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
984 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
985 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
986 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
987 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
988 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
989 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
990 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
991 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
992 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
993 2831864461 Roseateles noduli HZ7 Isolate Nodule
994 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
995 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
996 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
997 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
998 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
999 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
1000 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
1001 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
1002 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
1003 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
1004 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
1005 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
1006 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
1007 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
1008 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
1009 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
1010 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
1011 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
1012 2842694124 Methylopila sp. R-72369 Isolate Unclassified
1013 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
1014 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
1015 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
1016 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
1017 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
1018 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
1019 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
1020 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
1021 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
1022 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
1023 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
1024 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
1025 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
1026 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
1027 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
1028 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
1029 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
1030 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
1031 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
1032 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
1033 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
1034 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
1035 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
1036 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
1037 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
1038 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
1039 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
1040 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
1041 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
1042 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
1043 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
1044 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
1045 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
1046 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
1047 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
1048 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
1049 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
1050 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
1051 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
1052 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
1053 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
1054 2867369537 Streptomyces sp. Z26 Isolate Unclassified
1055 2867428634 Streptomyces sp. RP5T Isolate Unclassified
1056 2867475112 Streptomyces sp. TM32 Isolate Unclassified
1057 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
1058 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
1059 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
1060 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
1061 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
1062 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
1063 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
1064 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
1065 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
1066 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
1067 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
1068 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
1069 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
1070 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
1071 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
1072 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
1073 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
1074 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
1075 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
1076 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
1077 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
1078 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
1079 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
1080 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
1081 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
1082 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
1083 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
1084 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
1085 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
1086 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
1087 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
1088 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
1089 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
1090 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
1091 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
1092 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
1093 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
1094 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
1095 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
1096 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
1097 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
1098 2884411467 Dyella sp. AD56 Isolate Rhizosphere
1099 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
1100 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
1101 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
1102 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
1103 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
1104 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
1105 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
1106 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
1107 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
1108 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
1109 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
1110 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
1111 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
1112 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
1113 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
1114 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
1115 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
1116 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
1117 2891562705 Microbispora tritici MT50 Isolate Unclassified
1118 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
1119 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
1120 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
1121 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
1122 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
1123 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
1124 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
1125 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
1126 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
1127 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
1128 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
1129 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
1130 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
1131 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
1132 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
1133 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
1134 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
1135 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
1136 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
1137 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
1138 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
1139 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
1140 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
1141 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
1142 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
1143 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
1144 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
1145 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
1146 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
1147 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
1148 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
1149 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
1150 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
1151 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
1152 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
1153 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
1154 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
1155 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
1156 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
1157 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
1158 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
1159 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
1160 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
1161 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
1162 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
1163 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
1164 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
1165 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
1166 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
1167 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
1168 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
1169 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
1170 2919085039 Luteibacter sp. 1214 Isolate Unclassified
1171 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
1172 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
1173 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
1174 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
1175 2919404418 Luteibacter sp. 3190 Isolate Unclassified
1176 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
1177 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
1178 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
1179 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
1180 2919476304 Duganella sp. 3397 Isolate Unclassified
1181 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
1182 2919513703 Luteimonas sp. 3794 Isolate Unclassified
1183 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
1184 2919675420 Luteimonas terrae 4099 Isolate Unclassified
1185 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
1186 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
1187 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
1188 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
1189 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
1190 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
1191 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
1192 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
1193 2922554459 Rhodococcus sp. 66b Isolate Unclassified
1194 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
1195 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
1196 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
1197 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
1198 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
1199 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
1200 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
1201 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
1202 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
1203 2928163908 Burkholderia sp. 567 Isolate Unclassified
1204 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
1205 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
1206 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
1207 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
1208 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
1209 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
1210 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
1211 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
1212 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
1213 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
1214 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
1215 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
1216 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
1217 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
1218 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
1219 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
1220 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
1221 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
1222 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
1223 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
1224 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
1225 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
1226 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
1227 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
1228 2952252522 Salinicola sp. DM10 Isolate Unclassified
1229 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
1230 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
1231 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
1232 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
1233 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
1234 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
1235 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
1236 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
1237 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
1238 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
1239 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
1240 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
1241 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
1242 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
1243 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
1244 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
1245 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
1246 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
1247 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
1248 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
1249 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
1250 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
1251 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
1252 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
1253 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
1254 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
1255 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
1256 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
1257 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
1258 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
1259 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
1260 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
1261 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1262 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1263 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
1264 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1265 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
1266 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
1267 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
1268 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
1269 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
1270 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
1271 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1272 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1273 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
1274 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
1275 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1276 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1277 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
1278 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
1279 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1280 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
1281 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
1282 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
1283 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
1284 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
1285 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
1286 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1287 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1288 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
1289 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
1290 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
1291 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
1292 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
1293 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
1294 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
1295 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1296 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
1297 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
1298 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
1299 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
1300 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
1301 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
1302 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
1303 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1304 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1305 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1306 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1307 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1308 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1309 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1310 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
1311 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
1312 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
1313 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
1314 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
1315 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
1316 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
1317 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
1318 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
1319 637000116 Frankia casuarinae CcI3 Isolate Nodule
1320 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1321 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
1322 639633007 Azoarcus olearius BH72 Isolate Unclassified
1323 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
1324 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
1325 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1326 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1327 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
1328 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
1329 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
1330 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1331 8002784119 Frankia sp. AgB1.9 Isolate Nodule
1332 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
1333 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1334 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1335 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1336 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1337 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1338 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1339 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1340 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1341 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1342 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1343 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1344 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1345 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
1346 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
1347 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
1348 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
1349 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
1350 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1351 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1352 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
1353 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
1354 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
1355 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
1356 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
1357 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
1358 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
1359 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
1360 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
1361 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
1362 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
1363 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
1364 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
1365 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
1366 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
1367 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
1368 8052494512 Pseudomonas putida LD6 Isolate Unclassified
1369 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
1370 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
1371 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
1372 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
1373 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
1374 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
1375 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
1376 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1377 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
1378 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
1379 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
1380 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
1381 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
1382 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
1383 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
1384 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
1385 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
1386 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
1387 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
1388 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
1389 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere
1390 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1391 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.62
Metatranscriptomes 1.51
Isolates 16.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 9.46
Nodule 4.65
Rhizoplane 3.71
Rhizosphere 67.49
Stem 0
Stem Tuber 0.05
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1758216 2162886007 Bacteria 61617
2 SwRhRL2b_contig_2631586 2162886007 Bacteria 27217
3 SwRhRL2b_contig_564562 2162886007 Bacteria 15552
4 SwRhRL2b_contig_936608 2162886007 Bacteria 3188
5 ARSoilOldRDRAFT_c000001 3300000044 Bacteria 104759
6 LJNas_1000361 3300000546 Bacteria 7963
7 LJNas_1001976 3300000546 Bacteria 2641
8 JGI24746J21847_1000807 3300001977 Bacteria 4828
9 JGI24740J21852_10000672 3300001979 Bacteria 14821
10 JGI24740J21852_10002015 3300001979 Bacteria 9288
11 JGI24740J21852_10005770 3300001979 Bacteria 5200
12 JGI24740J21852_10015975 3300001979 Bacteria 2725
13 JGI24739J22299_10006818 3300001989 Bacteria 4300
14 JGI24737J22298_10000431 3300001990 Bacteria 14380
15 JGI24735J21928_10001372 3300002067 Bacteria 8617
16 JGI24738J21930_10000975 3300002075 Bacteria 8198
17 JGI25155J39150_1000020 3300002704 Bacteria 152963
18 JGI25155J39150_1000086 3300002704 Bacteria 52913
19 JGI25156J39149_1000021 3300002705 Bacteria 152968
20 JGI25156J39149_1000063 3300002705 Bacteria 84312
21 JGI25156J39149_1000111 3300002705 Bacteria 59224
22 JGI25156J39149_1001299 3300002705 Bacteria 10801
23 JGI25162J39368_1000053 3300002737 Bacteria 148653
24 JGI25162J39368_1000114 3300002737 Bacteria 88296
25 JGI25162J39368_1000198 3300002737 Bacteria 63149
26 JGI25162J39368_1000361 3300002737 Bacteria 38800
27 JGI25162J39368_1001741 3300002737 Bacteria 10448
28 JGI25154J39366_1000039 3300002738 Bacteria 152972
29 JGI25154J39366_1000134 3300002738 Bacteria 58169
30 JGI25154J39366_1000533 3300002738 Bacteria 19083
31 JGI25158J39367_1000342 3300002739 Bacteria 10298
32 JGI25157J39369_1000019 3300002741 Bacteria 176591
33 JGI25157J39369_1000082 3300002741 Bacteria 84303
34 JGI25157J39369_1000152 3300002741 Bacteria 58260
35 JGI25157J39369_1000172 3300002741 Bacteria 54469
36 JGI25163J39215_1000117 3300002771 Bacteria 33528
37 JGI25163J39215_1000270 3300002771 Bacteria 18361
38 JGI25164J39214_1000042 3300002772 Bacteria 126523
39 JGI25164J39214_1000130 3300002772 Bacteria 72405
40 JGI25164J39214_1000261 3300002772 Bacteria 39736
41 JGI25152J39213_1000523 3300002773 Bacteria 21314
42 JGI25152J39213_1000918 3300002773 Bacteria 14447
43 JGI25152J39213_1004581 3300002773 Bacteria 4306
44 JGI25150J39212_1000928 3300002774 Bacteria 9507
45 JGI25159J45721_1000110 3300002987 Bacteria 38863
46 JGI25159J45721_1000873 3300002987 Bacteria 13093
47 JGI25159J45721_1001476 3300002987 Bacteria 9701
48 JGI25159J45721_1001681 3300002987 Bacteria 8966
49 JGI25159J45721_1001834 3300002987 Bacteria 8497
50 JGI25151J46595_10000181 3300003187 Bacteria 79677
51 JGI25151J46595_10000321 3300003187 Bacteria 51966
52 JGI25151J46595_10001115 3300003187 Bacteria 19604
53 JGI25151J46595_10006979 3300003187 Bacteria 5592
54 JGI25151J46595_10009369 3300003187 Bacteria 4642
55 JGI25406J46586_10001223 3300003203 Bacteria 12083
56 JGI25406J46586_10002129 3300003203 Bacteria 9352
57 JGI25406J46586_10007760 3300003203 Bacteria 4882
58 JGI25165J46597_1000060 3300003214 Bacteria 208907
59 JGI25165J46597_1000209 3300003214 Bacteria 83865
60 JGI25165J46597_1000232 3300003214 Bacteria 77724
61 JGI25165J46597_1000299 3300003214 Bacteria 62544
62 JGI25165J46597_1001867 3300003214 Bacteria 8664
63 JGI25165J46597_1003441 3300003214 Bacteria 3957
64 JGI25153J46596_10013257 3300003215 Bacteria 3496
65 rootH2_10000063 3300003320 Bacteria 93226
66 JGI25160J50197_1000007 3300003354 Bacteria 316012
67 JGI25160J50197_1002492 3300003354 Bacteria 8556
68 JGI25407J50210_10000533 3300003373 Bacteria 7670
69 JGI25161J50226_1000096 3300003374 Bacteria 72203
70 JGI25161J50226_1000109 3300003374 Bacteria 64835
71 JGI25161J50226_1000455 3300003374 Bacteria 18975
72 JGI25161J50226_1000873 3300003374 Bacteria 11075
73 Ga0006556J51387_1016523 3300003479 Bacteria 2339
74 Ga0007417J51691_1038973 3300003544 Bacteria 2403
75 Ga0007417J51691_1047384 3300003544 Bacteria 2281
76 Ga0006554J51385_1012457 3300003567 Bacteria 2344
77 Ga0006562J51391_1005712 3300003578 Bacteria 2330
78 Ga0006562J51391_1012446 3300003578 Bacteria 3585
79 Ga0006562J51391_1030291 3300003578 Bacteria 2430
80 Ga0006562J51391_1040575 3300003578 Bacteria 3120
81 Ga0006562J51391_1097156 3300003578 Bacteria 5497
82 Ga0055538_1000013 3300003751 Bacteria 348596
83 Ga0055539_1000018 3300003752 Bacteria 348596
84 Ga0055539_1000602 3300003752 Bacteria 9943
85 Ga0055539_1000767 3300003752 Bacteria 7776
86 Ga0055533_1000022 3300003756 Bacteria 348596
87 Ga0055533_1000043 3300003756 Bacteria 229262
88 Ga0055525_1000024 3300003759 Bacteria 348596
89 Ga0055525_1000031 3300003759 Bacteria 314909
90 Ga0055525_1000192 3300003759 Bacteria 72944
91 Ga0055525_1001195 3300003759 Bacteria 5819
92 Ga0055527_1000041 3300003760 Bacteria 116981
93 Ga0055527_1000466 3300003760 Bacteria 15580
94 Ga0055535_1000079 3300003761 Bacteria 109482
95 Ga0055535_1000193 3300003761 Bacteria 64634
96 Ga0055535_1001154 3300003761 Bacteria 15575
97 Ga0055535_1001333 3300003761 Bacteria 13057
98 Ga0055542_1000152 3300003762 Bacteria 87561
99 Ga0055542_1000183 3300003762 Bacteria 77794
100 Ga0055542_1001024 3300003762 Bacteria 17604
101 Ga0055542_1001148 3300003762 Bacteria 15575
102 Ga0055529_1000464 3300003763 Bacteria 39223
103 Ga0055529_1000511 3300003763 Bacteria 34648
104 Ga0055529_1000934 3300003763 Bacteria 15580
105 Ga0055526_1001612 3300003771 Bacteria 15841
106 Ga0055526_1001820 3300003771 Bacteria 14753
107 Ga0055526_1003708 3300003771 Bacteria 9545
108 Ga0055526_1005773 3300003771 Bacteria 6978
109 Ga0055537_1000086 3300003773 Bacteria 67416
110 Ga0055537_1000368 3300003773 Bacteria 30732
111 Ga0055524_1000093 3300003775 Bacteria 111953
112 Ga0055524_1000157 3300003775 Bacteria 79002
113 Ga0055524_1000194 3300003775 Bacteria 66522
114 Ga0055524_1001239 3300003775 Bacteria 15047
115 Ga0055524_1001675 3300003775 Bacteria 12344
116 Ga0055524_1004780 3300003775 Bacteria 6182
117 Ga0055524_1005098 3300003775 Bacteria 5938
118 Ga0055524_1006153 3300003775 Bacteria 5243
119 Ga0055536_1000015 3300003781 Bacteria 237585
120 Ga0055536_1000090 3300003781 Bacteria 77889
121 Ga0055536_1000115 3300003781 Bacteria 69846
122 Ga0055536_1000214 3300003781 Bacteria 47510
123 Ga0055536_1001307 3300003781 Bacteria 15299
124 Ga0055536_1002997 3300003781 Bacteria 9246
125 Ga0055536_1007825 3300003781 Bacteria 4712
126 Ga0055536_1017564 3300003781 Bacteria 2335
127 Ga0055534_1000110 3300003784 Bacteria 60793
128 Ga0055534_1000938 3300003784 Bacteria 13004
129 Ga0055534_1003609 3300003784 Bacteria 4808
130 Ga0055534_1003859 3300003784 Bacteria 4570
131 Ga0055528_1000131 3300003790 Bacteria 60697
132 Ga0055528_1000151 3300003790 Bacteria 57434
133 Ga0055528_1000961 3300003790 Bacteria 19107
134 Ga0055530_10000541 3300003791 Bacteria 32834
135 Ga0055530_10001776 3300003791 Bacteria 14992
136 Ga0055530_10003231 3300003791 Bacteria 9516
137 Ga0055530_10003923 3300003791 Bacteria 8069
138 Ga0055530_10005511 3300003791 Bacteria 5988
139 Ga0055530_10007421 3300003791 Bacteria 4623
140 Ga0055540_1000024 3300003792 Bacteria 199164
141 Ga0055540_1000089 3300003792 Bacteria 100214
142 Ga0055540_1000204 3300003792 Bacteria 57435
143 Ga0055540_1001962 3300003792 Bacteria 11500
144 Ga0055540_1002979 3300003792 Bacteria 8493
145 Ga0055540_1015122 3300003792 Bacteria 2263
146 Ga0055531_10000186 3300003794 Bacteria 69495
147 Ga0055531_10001224 3300003794 Bacteria 19583
148 Ga0055531_10002330 3300003794 Bacteria 12823
149 Ga0055531_10002687 3300003794 Bacteria 11716
150 Ga0055531_10002748 3300003794 Bacteria 11555
151 Ga0055531_10003738 3300003794 Bacteria 9559
152 Ga0055531_10006866 3300003794 Bacteria 6344
153 Ga0055531_10008466 3300003794 Bacteria 5414
154 Ga0055531_10011033 3300003794 Bacteria 4415
155 Ga0055531_10013404 3300003794 Bacteria 3778
156 Ga0055531_10019816 3300003794 Bacteria 2699
157 Ga0055541_1000013 3300003841 Bacteria 348596
158 Ga0055543_1000045 3300004625 Bacteria 115098
159 Ga0055543_1000400 3300004625 Bacteria 27726
160 Ga0055543_1001093 3300004625 Bacteria 11808
161 Ga0055543_1001304 3300004625 Bacteria 10245
162 Ga0065165_1000011 3300005262 Bacteria 316465
163 Ga0065165_1000239 3300005262 Bacteria 94061
164 Ga0065165_1000907 3300005262 Bacteria 38180
165 Ga0065165_1001245 3300005262 Bacteria 29031
166 Ga0065165_1003901 3300005262 Bacteria 9861
167 Ga0065704_10000913 3300005289 Bacteria 12778
168 Ga0065704_10002398 3300005289 Bacteria 5304
169 Ga0065704_10070148 3300005289 Bacteria 264542
170 Ga0065704_10070209 3300005289 Bacteria 78459
171 Ga0065704_10070386 3300005289 Bacteria 27813
172 Ga0065704_10072392 3300005289 Bacteria 8612
173 Ga0065704_10073572 3300005289 Bacteria 7002
174 Ga0065712_10000310 3300005290 Bacteria 17827
175 Ga0065715_10001068 3300005293 Bacteria 20888
176 Ga0065707_10082997 3300005295 Bacteria 10960
177 Ga0070658_10000361 3300005327 Bacteria 39525
178 Ga0070658_10003762 3300005327 Bacteria 12420
179 Ga0070658_10004735 3300005327 Bacteria 11067
180 Ga0070658_10008111 3300005327 Bacteria 8446
181 Ga0070658_10011334 3300005327 Bacteria 7148
182 Ga0070658_10023208 3300005327 Bacteria 4981
183 Ga0070676_10002599 3300005328 Bacteria 9292
184 Ga0070676_10009251 3300005328 Bacteria 5325
185 Ga0070683_100000016 3300005329 Bacteria 207892
186 Ga0070683_100001338 3300005329 Bacteria 18785
187 Ga0070683_100006728 3300005329 Bacteria 9656
188 Ga0070683_100034592 3300005329 Bacteria 4617
189 Ga0070683_100069334 3300005329 Bacteria 3287
190 Ga0070683_100079311 3300005329 Bacteria 3073
191 Ga0070690_100001414 3300005330 Bacteria 12539
192 Ga0070690_100019994 3300005330 Bacteria 4075
193 Ga0070670_100000843 3300005331 Bacteria 23971
194 Ga0070670_100001934 3300005331 Bacteria 16954
195 Ga0070670_100012615 3300005331 Bacteria 7235
196 Ga0070670_100061127 3300005331 Bacteria 3234
197 Ga0070677_10006674 3300005333 Bacteria 3838
198 Ga0070677_10019598 3300005333 Bacteria 2453
199 Ga0068869_100005151 3300005334 Bacteria 8201
200 Ga0068869_100019852 3300005334 Bacteria 4600
201 Ga0068869_100024251 3300005334 Bacteria 4200
202 Ga0068869_100027424 3300005334 Bacteria 3971
203 Ga0070666_10001031 3300005335 Bacteria 17060
204 Ga0070666_10021453 3300005335 Bacteria 4187
205 Ga0070666_10035255 3300005335 Bacteria 3318
206 Ga0070666_10039495 3300005335 Bacteria 3146
207 Ga0070680_100003069 3300005336 Bacteria 12391
208 Ga0070682_100007364 3300005337 Bacteria 6209
209 Ga0070682_100019612 3300005337 Bacteria 3969
210 Ga0070682_100032998 3300005337 Bacteria 3142
211 Ga0070682_100035669 3300005337 Bacteria 3037
212 Ga0068868_100000189 3300005338 Bacteria 41014
213 Ga0068868_100092431 3300005338 Bacteria 2439
214 Ga0070660_100000453 3300005339 Bacteria 27360
215 Ga0070660_100019910 3300005339 Bacteria 4924
216 Ga0070660_100077176 3300005339 Bacteria 2610
217 Ga0070689_100004325 3300005340 Bacteria 9590
218 Ga0070689_100013429 3300005340 Bacteria 5925
219 Ga0070689_100021565 3300005340 Bacteria 4799
220 Ga0070687_100004260 3300005343 Bacteria 5687
221 Ga0070661_100014037 3300005344 Bacteria 5635
222 Ga0070661_100053255 3300005344 Bacteria 2961
223 Ga0070692_10022372 3300005345 Bacteria 3087
224 Ga0070668_100000663 3300005347 Bacteria 23311
225 Ga0070668_100003580 3300005347 Bacteria 11461
226 Ga0070668_100004005 3300005347 Bacteria 10904
227 Ga0070668_100014372 3300005347 Bacteria 5915
228 Ga0070668_100048177 3300005347 Bacteria 3277
229 Ga0070668_100054233 3300005347 Bacteria 3092
230 Ga0070669_100004348 3300005353 Bacteria 10228
231 Ga0070669_100014859 3300005353 Bacteria 5547
232 Ga0070669_100016068 3300005353 Bacteria 5340
233 Ga0070669_100032830 3300005353 Bacteria 3751
234 Ga0070669_100034171 3300005353 Bacteria 3681
235 Ga0070675_100006892 3300005354 Bacteria 8724
236 Ga0070675_100008848 3300005354 Bacteria 7826
237 Ga0070675_100010414 3300005354 Bacteria 7264
238 Ga0070675_100022653 3300005354 Bacteria 5019
239 Ga0070675_100112303 3300005354 Bacteria 2307
240 Ga0070671_100002648 3300005355 Bacteria 13855
241 Ga0070671_100017761 3300005355 Bacteria 5767
242 Ga0070671_100033370 3300005355 Bacteria 4256
243 Ga0070671_100040985 3300005355 Bacteria 3847
244 Ga0070671_100095690 3300005355 Bacteria 2489
245 Ga0070674_100001433 3300005356 Bacteria 12687
246 Ga0070674_100004934 3300005356 Bacteria 7647
247 Ga0070674_100005296 3300005356 Bacteria 7431
248 Ga0070674_100007155 3300005356 Bacteria 6563
249 Ga0070674_100015712 3300005356 Bacteria 4733
250 Ga0070674_100031780 3300005356 Bacteria 3501
251 Ga0070673_100001897 3300005364 Bacteria 12540
252 Ga0070673_100002248 3300005364 Bacteria 11694
253 Ga0070673_100003189 3300005364 Bacteria 10161
254 Ga0070673_100021362 3300005364 Bacteria 4691
255 Ga0070673_100035246 3300005364 Bacteria 3793
256 Ga0070688_100004918 3300005365 Bacteria 6990
257 Ga0070659_100000044 3300005366 Bacteria 102261
258 Ga0070659_100002036 3300005366 Bacteria 14461
259 Ga0070659_100009166 3300005366 Bacteria 7259
260 Ga0070659_100014285 3300005366 Bacteria 5929
261 Ga0070659_100047347 3300005366 Bacteria 3372
262 Ga0070667_100000568 3300005367 Bacteria 36558
263 Ga0070667_100004373 3300005367 Bacteria 11926
264 Ga0070667_100004815 3300005367 Bacteria 11307
265 Ga0070667_100006832 3300005367 Bacteria 9476
266 Ga0070667_100009985 3300005367 Bacteria 7868
267 Ga0070667_100012179 3300005367 Bacteria 7117
268 Ga0070667_100013535 3300005367 Bacteria 6741
269 Ga0070667_100017461 3300005367 Bacteria 5947
270 Ga0070667_100036150 3300005367 Bacteria 4140
271 Ga0070667_100106889 3300005367 Bacteria 2422
272 Ga0070709_10019207 3300005434 Bacteria 3946
273 Ga0070709_10023088 3300005434 Bacteria 3647
274 Ga0070709_10024646 3300005434 Bacteria 3544
275 Ga0070709_10025639 3300005434 Bacteria 3485
276 Ga0070709_10035715 3300005434 Bacteria 3022
277 Ga0070714_100000012 3300005435 Bacteria 226258
278 Ga0070714_100000111 3300005435 Bacteria 67800
279 Ga0070714_100000503 3300005435 Bacteria 28380
280 Ga0070714_100003404 3300005435 Bacteria 11850
281 Ga0070714_100013350 3300005435 Bacteria 6584
282 Ga0070714_100025554 3300005435 Bacteria 4874
283 Ga0070713_100012733 3300005436 Bacteria 6181
284 Ga0070713_100020435 3300005436 Bacteria 5076
285 Ga0070713_100029178 3300005436 Bacteria 4366
286 Ga0070713_100048342 3300005436 Bacteria 3502
287 Ga0070713_100051862 3300005436 Bacteria 3395
288 Ga0070713_100077508 3300005436 Bacteria 2826
289 Ga0070713_100088761 3300005436 Bacteria 2654
290 Ga0070710_10001493 3300005437 Bacteria 11016
291 Ga0070710_10003261 3300005437 Bacteria 7689
292 Ga0070710_10017407 3300005437 Bacteria 3676
293 Ga0070710_10035280 3300005437 Bacteria 2726
294 Ga0070701_10018135 3300005438 Bacteria 3304
295 Ga0070711_100006992 3300005439 Bacteria 6845
296 Ga0070711_100015682 3300005439 Bacteria 4797
297 Ga0070711_100017220 3300005439 Bacteria 4598
298 Ga0070705_100034687 3300005440 Bacteria 2822
299 Ga0070700_100000010 3300005441 Bacteria 176885
300 Ga0070700_100003787 3300005441 Bacteria 7828
301 Ga0070694_100006416 3300005444 Bacteria 7135
302 Ga0070694_100006609 3300005444 Bacteria 7045
303 Ga0070694_100035150 3300005444 Bacteria 3310
304 Ga0070708_100000445 3300005445 Bacteria 30891
305 Ga0070708_100005044 3300005445 Bacteria 10447
306 Ga0070663_100000355 3300005455 Bacteria 24103
307 Ga0070678_100000623 3300005456 Bacteria 17360
308 Ga0070678_100004562 3300005456 Bacteria 7863
309 Ga0070678_100017552 3300005456 Bacteria 4613
310 Ga0070678_100028398 3300005456 Bacteria 3814
311 Ga0070678_100083021 3300005456 Bacteria 2435
312 Ga0070662_100000592 3300005457 Bacteria 22043
313 Ga0070662_100002736 3300005457 Bacteria 10896
314 Ga0070662_100005408 3300005457 Bacteria 8160
315 Ga0070662_100009068 3300005457 Bacteria 6490
316 Ga0070681_10007707 3300005458 Bacteria 10524
317 Ga0070681_10010876 3300005458 Bacteria 8995
318 Ga0070681_10016483 3300005458 Bacteria 7378
319 Ga0070681_10024247 3300005458 Bacteria 6107
320 Ga0070681_10027191 3300005458 Bacteria 5752
321 Ga0070681_10027211 3300005458 Bacteria 5750
322 Ga0070681_10037995 3300005458 Bacteria 4828
323 Ga0070681_10057012 3300005458 Bacteria 3887
324 Ga0070681_10105862 3300005458 Bacteria 2755
325 Ga0068867_100001767 3300005459 Bacteria 15038
326 Ga0068867_100002156 3300005459 Bacteria 13800
327 Ga0068867_100004253 3300005459 Bacteria 10074
328 Ga0068867_100010372 3300005459 Bacteria 6574
329 Ga0068867_100019645 3300005459 Bacteria 4812
330 Ga0068867_100021371 3300005459 Bacteria 4617
331 Ga0068867_100052977 3300005459 Bacteria 2995
332 Ga0070685_10004896 3300005466 Bacteria 6773
333 Ga0070706_100000427 3300005467 Bacteria 50722
334 Ga0070706_100003818 3300005467 Bacteria 14720
335 Ga0070706_100003859 3300005467 Bacteria 14640
336 Ga0070706_100016043 3300005467 Bacteria 6916
337 Ga0070706_100016490 3300005467 Bacteria 6826
338 Ga0070706_100038340 3300005467 Bacteria 4423
339 Ga0070707_100000731 3300005468 Bacteria 32690
340 Ga0070707_100014623 3300005468 Bacteria 7357
341 Ga0070707_100022531 3300005468 Bacteria 5955
342 Ga0070707_100032746 3300005468 Bacteria 4953
343 Ga0070707_100057704 3300005468 Bacteria 3724
344 Ga0070707_100106988 3300005468 Bacteria 2713
345 Ga0070698_100000799 3300005471 Bacteria 34263
346 Ga0070698_100004397 3300005471 Bacteria 15483
347 Ga0070698_100006976 3300005471 Bacteria 12230
348 Ga0070698_100014672 3300005471 Bacteria 8276
349 Ga0070698_100022793 3300005471 Bacteria 6548
350 Ga0070698_100039563 3300005471 Bacteria 4852
351 Ga0070698_100047944 3300005471 Bacteria 4366
352 Ga0070698_100050657 3300005471 Bacteria 4232
353 Ga0070699_100000561 3300005518 Bacteria 35084
354 Ga0070699_100002515 3300005518 Bacteria 16459
355 Ga0070679_100005118 3300005530 Bacteria 12116
356 Ga0070679_100009281 3300005530 Bacteria 9299
357 Ga0070679_100010613 3300005530 Bacteria 8743
358 Ga0070679_100041021 3300005530 Bacteria 4607
359 Ga0070679_100080552 3300005530 Bacteria 3245
360 Ga0070684_100000005 3300005535 Bacteria 230164
361 Ga0070684_100001665 3300005535 Bacteria 16133
362 Ga0070684_100008934 3300005535 Bacteria 7866
363 Ga0070684_100016171 3300005535 Bacteria 6095
364 Ga0070684_100021998 3300005535 Bacteria 5313
365 Ga0070684_100122875 3300005535 Bacteria 2336
366 Ga0070697_100060395 3300005536 Bacteria 3090
367 Ga0070697_100074583 3300005536 Bacteria 2787
368 Ga0070697_100077558 3300005536 Bacteria 2733
369 Ga0068853_100000206 3300005539 Bacteria 41721
370 Ga0068853_100000817 3300005539 Bacteria 21716
371 Ga0068853_100005837 3300005539 Bacteria 9696
372 Ga0068853_100009750 3300005539 Bacteria 7746
373 Ga0068853_100021311 3300005539 Bacteria 5402
374 Ga0068853_100029004 3300005539 Bacteria 4659
375 Ga0070672_100003218 3300005543 Bacteria 10569
376 Ga0070672_100004006 3300005543 Bacteria 9604
377 Ga0070672_100074351 3300005543 Bacteria 2711
378 Ga0070686_100001815 3300005544 Bacteria 11902
379 Ga0070686_100029815 3300005544 Bacteria 3323
380 Ga0070686_100062582 3300005544 Bacteria 2408
381 Ga0070695_100017383 3300005545 Bacteria 4360
382 Ga0070695_100021479 3300005545 Bacteria 3951
383 Ga0070696_100043939 3300005546 Bacteria 3093
384 Ga0070693_100005796 3300005547 Bacteria 5966
385 Ga0070693_100008593 3300005547 Bacteria 5045
386 Ga0070665_100000008 3300005548 Bacteria 606341
387 Ga0070665_100001702 3300005548 Bacteria 25283
388 Ga0070665_100002610 3300005548 Bacteria 19669
389 Ga0070665_100003073 3300005548 Bacteria 17977
390 Ga0070665_100015503 3300005548 Bacteria 7656
391 Ga0070665_100023874 3300005548 Bacteria 6160
392 Ga0070665_100042618 3300005548 Bacteria 4562
393 Ga0070665_100068347 3300005548 Bacteria 3562
394 Ga0070665_100078736 3300005548 Bacteria 3302
395 Ga0070665_100136837 3300005548 Bacteria 2453
396 Ga0070704_100018762 3300005549 Bacteria 4431
397 Ga0070704_100023018 3300005549 Bacteria 4061
398 Ga0070704_100024043 3300005549 Bacteria 3992
399 Ga0070704_100029565 3300005549 Bacteria 3660
400 Ga0068855_100000030 3300005563 Bacteria 171124
401 Ga0068855_100000174 3300005563 Bacteria 82404
402 Ga0068855_100000622 3300005563 Bacteria 43596
403 Ga0068855_100000899 3300005563 Bacteria 36852
404 Ga0068855_100002708 3300005563 Bacteria 21839
405 Ga0068855_100007920 3300005563 Bacteria 12838
406 Ga0068855_100011705 3300005563 Bacteria 10601
407 Ga0068855_100014140 3300005563 Bacteria 9615
408 Ga0068855_100016224 3300005563 Bacteria 8958
409 Ga0068855_100018840 3300005563 Bacteria 8297
410 Ga0068855_100022808 3300005563 Bacteria 7501
411 Ga0068855_100023137 3300005563 Bacteria 7445
412 Ga0068855_100085801 3300005563 Bacteria 3642
413 Ga0068855_100100340 3300005563 Bacteria 3333
414 Ga0068855_100104206 3300005563 Bacteria 3263
415 Ga0070664_100006445 3300005564 Bacteria 9464
416 Ga0070664_100018879 3300005564 Bacteria 5668
417 Ga0070664_100029553 3300005564 Bacteria 4569
418 Ga0070664_100032882 3300005564 Bacteria 4340
419 Ga0070664_100063534 3300005564 Bacteria 3148
420 Ga0070664_100070440 3300005564 Bacteria 2995
421 Ga0068857_100005288 3300005577 Bacteria 10989
422 Ga0068857_100041020 3300005577 Bacteria 4104
423 Ga0068854_100000026 3300005578 Bacteria 118880
424 Ga0068854_100003476 3300005578 Bacteria 9835
425 Ga0068856_100001902 3300005614 Bacteria 21771
426 Ga0068856_100007490 3300005614 Bacteria 10653
427 Ga0068856_100015703 3300005614 Bacteria 7320
428 Ga0068856_100016266 3300005614 Bacteria 7197
429 Ga0068856_100087408 3300005614 Bacteria 3099
430 Ga0070702_100000205 3300005615 Bacteria 19426
431 Ga0070702_100003996 3300005615 Bacteria 6689
432 Ga0068852_100002558 3300005616 Bacteria 12530
433 Ga0068852_100003282 3300005616 Bacteria 11293
434 Ga0068852_100015109 3300005616 Bacteria 5973
435 Ga0068852_100093928 3300005616 Bacteria 2689
436 Ga0068852_100096161 3300005616 Bacteria 2661
437 Ga0068859_100002091 3300005617 Bacteria 20333
438 Ga0068859_100016336 3300005617 Bacteria 7458
439 Ga0068859_100065985 3300005617 Bacteria 3654
440 Ga0068859_100078654 3300005617 Bacteria 3338
441 Ga0068859_100092949 3300005617 Bacteria 3068
442 Ga0068864_100003970 3300005618 Bacteria 12177
443 Ga0068864_100008109 3300005618 Bacteria 8660
444 Ga0068864_100025187 3300005618 Bacteria 5009
445 Ga0068864_100025482 3300005618 Bacteria 4981
446 Ga0068866_10000859 3300005718 Bacteria 13455
447 Ga0068861_100000012 3300005719 Bacteria 81676
448 Ga0068861_100003932 3300005719 Bacteria 9934
449 Ga0068861_100022412 3300005719 Bacteria 4549
450 Ga0068861_100034409 3300005719 Bacteria 3746
451 Ga0068851_10000623 3300005834 Bacteria 15140
452 Ga0068851_10018953 3300005834 Bacteria 3322
453 Ga0068870_10018709 3300005840 Bacteria 3350
454 Ga0068863_100006371 3300005841 Bacteria 11578
455 Ga0068863_100011292 3300005841 Bacteria 8652
456 Ga0068863_100020240 3300005841 Bacteria 6365
457 Ga0068863_100020675 3300005841 Bacteria 6287
458 Ga0068863_100108597 3300005841 Bacteria 2640
459 Ga0068858_100000002 3300005842 Bacteria 351633
460 Ga0068858_100000882 3300005842 Bacteria 31130
461 Ga0068858_100001488 3300005842 Bacteria 24134
462 Ga0068858_100002571 3300005842 Bacteria 18283
463 Ga0068858_100003070 3300005842 Bacteria 16726
464 Ga0068858_100003072 3300005842 Bacteria 16717
465 Ga0068858_100004552 3300005842 Bacteria 13578
466 Ga0068858_100005302 3300005842 Bacteria 12640
467 Ga0068858_100005393 3300005842 Bacteria 12533
468 Ga0068858_100019961 3300005842 Bacteria 6266
469 Ga0068858_100044210 3300005842 Bacteria 4129
470 Ga0068858_100098922 3300005842 Bacteria 2720
471 Ga0068860_100000029 3300005843 Bacteria 259192
472 Ga0068860_100000142 3300005843 Bacteria 117670
473 Ga0068860_100000400 3300005843 Bacteria 56882
474 Ga0068860_100000487 3300005843 Bacteria 48973
475 Ga0068860_100001623 3300005843 Bacteria 24139
476 Ga0068860_100003858 3300005843 Bacteria 15403
477 Ga0068860_100021527 3300005843 Bacteria 6243
478 Ga0068860_100033772 3300005843 Bacteria 4909
479 Ga0068860_100073271 3300005843 Bacteria 3255
480 Ga0068860_100083736 3300005843 Bacteria 3034
481 Ga0068860_100089001 3300005843 Bacteria 2939
482 Ga0068862_100015121 3300005844 Bacteria 6410
483 Ga0068862_100019037 3300005844 Bacteria 5725
484 Ga0068862_100020519 3300005844 Bacteria 5520
485 Ga0068862_100024307 3300005844 Bacteria 5083
486 Ga0068862_100031285 3300005844 Bacteria 4491
487 Ga0068862_100033003 3300005844 Bacteria 4373
488 Ga0068862_100085118 3300005844 Bacteria 2747
489 Ga0081455_10000002 3300005937 Bacteria 460472
490 Ga0081455_10000047 3300005937 Bacteria 126804
491 Ga0081455_10000070 3300005937 Bacteria 110926
492 Ga0081455_10000198 3300005937 Bacteria 76277
493 Ga0081455_10000921 3300005937 Bacteria 37804
494 Ga0081455_10001544 3300005937 Bacteria 28365
495 Ga0081455_10003100 3300005937 Bacteria 19344
496 Ga0081455_10005985 3300005937 Bacteria 13194
497 Ga0081455_10010964 3300005937 Bacteria 9136
498 Ga0081455_10024669 3300005937 Bacteria 5563
499 Ga0081538_10000602 3300005981 Bacteria 39838
500 Ga0081540_1000079 3300005983 Bacteria 103786
501 Ga0081540_1000097 3300005983 Bacteria 92047
502 Ga0081540_1000654 3300005983 Bacteria 32728
503 Ga0081540_1001868 3300005983 Bacteria 17638
504 Ga0081540_1002433 3300005983 Bacteria 15156
505 Ga0081540_1004752 3300005983 Bacteria 10264
506 Ga0081540_1007088 3300005983 Bacteria 8053
507 Ga0081540_1009325 3300005983 Bacteria 6769
508 Ga0081540_1011079 3300005983 Bacteria 6054
509 Ga0081539_10000017 3300005985 Bacteria 375107
510 Ga0081539_10000504 3300005985 Bacteria 81870
511 Ga0081539_10000705 3300005985 Bacteria 66932
512 Ga0081539_10001004 3300005985 Bacteria 52369
513 Ga0081539_10001116 3300005985 Bacteria 48712
514 Ga0081539_10001133 3300005985 Bacteria 48396
515 Ga0081539_10005550 3300005985 Bacteria 12784
516 Ga0081539_10006570 3300005985 Bacteria 11071
517 Ga0081539_10031152 3300005985 Bacteria 3294
518 Ga0070717_10011265 3300006028 Bacteria 6785
519 Ga0070717_10012608 3300006028 Bacteria 6449
520 Ga0070717_10018731 3300006028 Bacteria 5414
521 Ga0070717_10067360 3300006028 Bacteria 2979
522 Ga0075365_10000652 3300006038 Bacteria 13817
523 Ga0075365_10008082 3300006038 Bacteria 5942
524 Ga0075365_10015519 3300006038 Bacteria 4610
525 Ga0075365_10026448 3300006038 Bacteria 3684
526 Ga0075365_10029207 3300006038 Bacteria 3522
527 Ga0075368_10000433 3300006042 Bacteria 12383
528 Ga0075368_10003166 3300006042 Bacteria 5470
529 Ga0075368_10011855 3300006042 Bacteria 3181
530 Ga0075363_100000351 3300006048 Bacteria 13820
531 Ga0075363_100016251 3300006048 Bacteria 3674
532 Ga0075363_100016577 3300006048 Bacteria 3641
533 Ga0075364_10000117 3300006051 Bacteria 32859
534 Ga0075364_10002086 3300006051 Bacteria 11167
535 Ga0075432_10003895 3300006058 Bacteria 5081
536 Ga0070715_10006934 3300006163 Bacteria 3876
537 Ga0070716_100000102 3300006173 Bacteria 33678
538 Ga0070716_100003015 3300006173 Bacteria 7853
539 Ga0070716_100012285 3300006173 Bacteria 4337
540 Ga0070712_100009357 3300006175 Bacteria 6170
541 Ga0070712_100014517 3300006175 Bacteria 5055
542 Ga0070712_100064625 3300006175 Bacteria 2595
543 Ga0075362_10001494 3300006177 Bacteria 7512
544 Ga0075362_10002201 3300006177 Bacteria 6469
545 Ga0075367_10001839 3300006178 Bacteria 9359
546 Ga0075367_10004358 3300006178 Bacteria 6898
547 Ga0075367_10011083 3300006178 Bacteria 4755
548 Ga0075369_10002115 3300006186 Bacteria 7020
549 Ga0075369_10005311 3300006186 Bacteria 4802
550 Ga0075366_10013063 3300006195 Bacteria 4722
551 Ga0097621_100000859 3300006237 Bacteria 21321
552 Ga0097621_100003399 3300006237 Bacteria 10957
553 Ga0097621_100012112 3300006237 Bacteria 6382
554 Ga0097621_100015684 3300006237 Bacteria 5710
555 Ga0097621_100020431 3300006237 Bacteria 5103
556 Ga0097621_100033850 3300006237 Bacteria 4073
557 Ga0097621_100081333 3300006237 Bacteria 2696
558 Ga0075370_10000875 3300006353 Bacteria 12276
559 Ga0075370_10002068 3300006353 Bacteria 9134
560 Ga0075370_10002601 3300006353 Bacteria 8415
561 Ga0075370_10002815 3300006353 Bacteria 8155
562 Ga0075370_10003792 3300006353 Bacteria 7238
563 Ga0075370_10015535 3300006353 Bacteria 4078
564 Ga0068871_100000004 3300006358 Bacteria 123358
565 Ga0068871_100010340 3300006358 Bacteria 6803
566 Ga0068871_100019035 3300006358 Bacteria 5234
567 Ga0068871_100058743 3300006358 Bacteria 3132
568 Ga0075428_100000658 3300006844 Bacteria 35511
569 Ga0075428_100001310 3300006844 Bacteria 26352
570 Ga0075428_100003058 3300006844 Bacteria 18253
571 Ga0075428_100007864 3300006844 Bacteria 11823
572 Ga0075428_100014285 3300006844 Bacteria 8829
573 Ga0075428_100018570 3300006844 Bacteria 7686
574 Ga0075428_100105528 3300006844 Bacteria 3072
575 Ga0075428_100110150 3300006844 Bacteria 2999
576 Ga0075428_100111390 3300006844 Bacteria 2982
577 Ga0075428_100148811 3300006844 Bacteria 2544
578 Ga0075428_100156255 3300006844 Bacteria 2478
579 Ga0075430_100000408 3300006846 Bacteria 31936
580 Ga0075430_100001396 3300006846 Bacteria 19610
581 Ga0075430_100011546 3300006846 Bacteria 7509
582 Ga0075430_100012145 3300006846 Bacteria 7331
583 Ga0075430_100020676 3300006846 Bacteria 5599
584 Ga0075430_100026363 3300006846 Bacteria 4946
585 Ga0075430_100040879 3300006846 Bacteria 3924
586 Ga0075431_100000386 3300006847 Bacteria 35302
587 Ga0075431_100000547 3300006847 Bacteria 31597
588 Ga0075431_100003378 3300006847 Bacteria 15476
589 Ga0075431_100004011 3300006847 Bacteria 14350
590 Ga0075431_100005630 3300006847 Bacteria 12373
591 Ga0075431_100009544 3300006847 Bacteria 9745
592 Ga0075431_100014429 3300006847 Bacteria 7992
593 Ga0075431_100015851 3300006847 Bacteria 7642
594 Ga0075431_100020761 3300006847 Bacteria 6712
595 Ga0075431_100055623 3300006847 Bacteria 4082
596 Ga0075431_100097457 3300006847 Bacteria 3036
597 Ga0075433_10001320 3300006852 Bacteria 18149
598 Ga0075433_10003371 3300006852 Bacteria 12351
599 Ga0075433_10007955 3300006852 Bacteria 8440
600 Ga0075433_10011059 3300006852 Bacteria 7260
601 Ga0075433_10012860 3300006852 Bacteria 6781
602 Ga0075433_10040107 3300006852 Bacteria 4051
603 Ga0075434_100005268 3300006871 Bacteria 11758
604 Ga0075434_100005620 3300006871 Bacteria 11428
605 Ga0075434_100024716 3300006871 Bacteria 5874
606 Ga0075434_100031784 3300006871 Bacteria 5205
607 Ga0075434_100044296 3300006871 Bacteria 4414
608 Ga0075434_100120216 3300006871 Bacteria 2642
609 Ga0075429_100000115 3300006880 Bacteria 46097
610 Ga0075429_100016489 3300006880 Bacteria 6401
611 Ga0075429_100024416 3300006880 Bacteria 5245
612 Ga0075429_100024594 3300006880 Bacteria 5226
613 Ga0068865_100002862 3300006881 Bacteria 10280
614 Ga0068865_100003922 3300006881 Bacteria 8930
615 Ga0075436_100005379 3300006914 Bacteria 8811
616 Ga0075436_100017190 3300006914 Bacteria 4950
617 Ga0075436_100028835 3300006914 Bacteria 3818
618 Ga0075436_100034604 3300006914 Bacteria 3484
619 Ga0097620_100002091 3300006931 Bacteria 20333
620 Ga0097620_100016336 3300006931 Bacteria 7458
621 Ga0097620_100065986 3300006931 Bacteria 3654
622 Ga0097620_100078655 3300006931 Bacteria 3338
623 Ga0097620_100092941 3300006931 Bacteria 3068
624 Ga0099823_1000009 3300006944 Bacteria 99451
625 Ga0099823_1000013 3300006944 Bacteria 90711
626 Ga0099823_1000061 3300006944 Bacteria 52139
627 Ga0079104_1000185 3300006946 Bacteria 88917
628 Ga0099826_10000004 3300006948 Bacteria 802669
629 Ga0075435_100009284 3300007076 Bacteria 7109
630 Ga0075435_100017795 3300007076 Bacteria 5386
631 Ga0075435_100053881 3300007076 Bacteria 3245
632 Ga0099794_10017598 3300007265 Bacteria 3188
633 Ga0105251_10000179 3300009011 Bacteria 63707
634 Ga0105251_10009224 3300009011 Bacteria 5849
635 Ga0105244_10000748 3300009036 Bacteria 27805
636 Ga0105244_10003121 3300009036 Bacteria 12070
637 Ga0105244_10003800 3300009036 Bacteria 10655
638 Ga0105244_10020231 3300009036 Bacteria 3700
639 Ga0105244_10029686 3300009036 Bacteria 2918
640 Ga0105244_10042139 3300009036 Bacteria 2362
641 Ga0105250_10000097 3300009092 Bacteria 78303
642 Ga0105250_10000296 3300009092 Bacteria 39296
643 Ga0105250_10000506 3300009092 Bacteria 27341
644 Ga0105240_10000012 3300009093 Bacteria 496639
645 Ga0105240_10000105 3300009093 Bacteria 172035
646 Ga0105240_10000200 3300009093 Bacteria 121941
647 Ga0105240_10000236 3300009093 Bacteria 110204
648 Ga0105240_10001559 3300009093 Bacteria 38902
649 Ga0105240_10002719 3300009093 Bacteria 28052
650 Ga0105240_10004456 3300009093 Bacteria 21350
651 Ga0105240_10012669 3300009093 Bacteria 11623
652 Ga0105240_10013551 3300009093 Bacteria 11190
653 Ga0105240_10018962 3300009093 Bacteria 9212
654 Ga0105240_10034919 3300009093 Bacteria 6483
655 Ga0105240_10038828 3300009093 Bacteria 6104
656 Ga0105240_10042452 3300009093 Bacteria 5795
657 Ga0105240_10044907 3300009093 Bacteria 5609
658 Ga0105240_10059425 3300009093 Bacteria 4771
659 Ga0105240_10086891 3300009093 Bacteria 3830
660 Ga0105240_10099787 3300009093 Bacteria 3533
661 Ga0105240_10104499 3300009093 Bacteria 3440
662 Ga0111539_10000003 3300009094 Bacteria 880006
663 Ga0111539_10007820 3300009094 Bacteria 13649
664 Ga0111539_10008250 3300009094 Bacteria 13259
665 Ga0111539_10010985 3300009094 Bacteria 11399
666 Ga0111539_10012293 3300009094 Bacteria 10731
667 Ga0111539_10043542 3300009094 Bacteria 5380
668 Ga0111539_10043863 3300009094 Bacteria 5360
669 Ga0111539_10062065 3300009094 Bacteria 4425
670 Ga0111539_10096248 3300009094 Bacteria 3477
671 Ga0105245_10000168 3300009098 Bacteria 62053
672 Ga0105245_10002616 3300009098 Bacteria 16220
673 Ga0105245_10004266 3300009098 Bacteria 12673
674 Ga0105245_10037025 3300009098 Bacteria 4336
675 Ga0105245_10041231 3300009098 Bacteria 4115
676 Ga0105245_10053313 3300009098 Bacteria 3630
677 Ga0105247_10000922 3300009101 Bacteria 22104
678 Ga0105247_10006357 3300009101 Bacteria 7317
679 Ga0105247_10011398 3300009101 Bacteria 5361
680 Ga0114129_10000014 3300009147 Bacteria 130267
681 Ga0114129_10001242 3300009147 Bacteria 33950
682 Ga0114129_10003040 3300009147 Bacteria 23511
683 Ga0114129_10004614 3300009147 Bacteria 19449
684 Ga0114129_10012134 3300009147 Bacteria 12267
685 Ga0114129_10039676 3300009147 Bacteria 6639
686 Ga0114129_10052729 3300009147 Bacteria 5709
687 Ga0114129_10066332 3300009147 Bacteria 5035
688 Ga0114129_10098880 3300009147 Bacteria 4039
689 Ga0105243_10000200 3300009148 Bacteria 69918
690 Ga0105243_10000491 3300009148 Bacteria 40396
691 Ga0105243_10002310 3300009148 Bacteria 15968
692 Ga0105243_10005388 3300009148 Bacteria 9984
693 Ga0105243_10039670 3300009148 Bacteria 3672
694 Ga0105241_10000052 3300009174 Bacteria 94908
695 Ga0105241_10012062 3300009174 Bacteria 6348
696 Ga0105241_10015563 3300009174 Bacteria 5575
697 Ga0105241_10047072 3300009174 Bacteria 3278
698 Ga0105241_10090723 3300009174 Bacteria 2410
699 Ga0105242_10004937 3300009176 Bacteria 10330
700 Ga0105242_10012996 3300009176 Bacteria 6421
701 Ga0105242_10017304 3300009176 Bacteria 5614
702 Ga0105242_10026113 3300009176 Bacteria 4627
703 Ga0105242_10032872 3300009176 Bacteria 4150
704 Ga0105242_10107506 3300009176 Bacteria 2373
705 Ga0105248_10000152 3300009177 Bacteria 80685
706 Ga0105248_10006731 3300009177 Bacteria 12608
707 Ga0105248_10008603 3300009177 Bacteria 11209
708 Ga0105248_10014110 3300009177 Bacteria 8793
709 Ga0105248_10018307 3300009177 Bacteria 7735
710 Ga0105248_10020421 3300009177 Bacteria 7339
711 Ga0105248_10046436 3300009177 Bacteria 4868
712 Ga0105248_10101309 3300009177 Bacteria 3246
713 Ga0105248_10107313 3300009177 Bacteria 3149
714 Ga0105237_10000504 3300009545 Bacteria 55287
715 Ga0105237_10000941 3300009545 Bacteria 39120
716 Ga0105237_10003110 3300009545 Bacteria 19993
717 Ga0105237_10011946 3300009545 Bacteria 9179
718 Ga0105237_10034192 3300009545 Bacteria 5148
719 Ga0105237_10046307 3300009545 Bacteria 4375
720 Ga0105237_10052600 3300009545 Bacteria 4087
721 Ga0105238_10001421 3300009551 Bacteria 23984
722 Ga0105238_10002760 3300009551 Bacteria 17515
723 Ga0105238_10007781 3300009551 Bacteria 10719
724 Ga0105238_10009963 3300009551 Bacteria 9530
725 Ga0105238_10023321 3300009551 Bacteria 6309
726 Ga0105238_10036301 3300009551 Bacteria 5009
727 Ga0105238_10042326 3300009551 Bacteria 4613
728 Ga0105238_10081505 3300009551 Bacteria 3225
729 Ga0105249_10000912 3300009553 Bacteria 26117
730 Ga0105249_10004063 3300009553 Bacteria 12619
731 Ga0105249_10014652 3300009553 Bacteria 6929
732 Ga0105249_10035762 3300009553 Bacteria 4504
733 Ga0105249_10062007 3300009553 Bacteria 3432
734 Ga0105249_10103389 3300009553 Bacteria 2683
735 Ga0105239_10000021 3300010375 Bacteria 259369
736 Ga0105239_10000028 3300010375 Bacteria 243470
737 Ga0105239_10000215 3300010375 Bacteria 85485
738 Ga0105239_10001674 3300010375 Bacteria 29219
739 Ga0105239_10002939 3300010375 Bacteria 21260
740 Ga0105239_10004452 3300010375 Bacteria 16750
741 Ga0105239_10004478 3300010375 Bacteria 16686
742 Ga0105239_10005115 3300010375 Bacteria 15479
743 Ga0105239_10007478 3300010375 Bacteria 12538
744 Ga0105239_10009229 3300010375 Bacteria 11156
745 Ga0105239_10011353 3300010375 Bacteria 9938
746 Ga0105239_10016985 3300010375 Bacteria 8045
747 Ga0105239_10018879 3300010375 Bacteria 7618
748 Ga0105239_10034621 3300010375 Bacteria 5547
749 Ga0105239_10043910 3300010375 Bacteria 4901
750 Ga0105246_10002067 3300011119 Bacteria 12091
751 Ga0105246_10007825 3300011119 Bacteria 6557
752 Ga0157319_1000005 3300012497 Bacteria 372810
753 Ga0157319_1000045 3300012497 Bacteria 20145
754 Ga0157345_1000004 3300012498 Bacteria 80365
755 Ga0157373_10000039 3300013100 Bacteria 117160
756 Ga0157373_10002206 3300013100 Bacteria 14740
757 Ga0157371_10001056 3300013102 Bacteria 30183
758 Ga0157371_10003350 3300013102 Bacteria 14602
759 Ga0157371_10016398 3300013102 Bacteria 5530
760 Ga0157371_10020105 3300013102 Bacteria 4915
761 Ga0157371_10035564 3300013102 Bacteria 3569
762 Ga0157370_10000033 3300013104 Bacteria 138137
763 Ga0157370_10001210 3300013104 Bacteria 32282
764 Ga0157370_10013679 3300013104 Bacteria 8342
765 Ga0157370_10035890 3300013104 Bacteria 4814
766 Ga0157370_10039286 3300013104 Bacteria 4573
767 Ga0157370_10068431 3300013104 Bacteria 3355
768 Ga0157369_10000286 3300013105 Bacteria 67677
769 Ga0157369_10000755 3300013105 Bacteria 41695
770 Ga0157369_10002422 3300013105 Bacteria 22422
771 Ga0157369_10002613 3300013105 Bacteria 21537
772 Ga0157369_10012015 3300013105 Bacteria 9835
773 Ga0157369_10018558 3300013105 Bacteria 7797
774 Ga0157369_10024665 3300013105 Bacteria 6685
775 Ga0157369_10027518 3300013105 Bacteria 6301
776 Ga0157369_10048536 3300013105 Bacteria 4606
777 Ga0157369_10092684 3300013105 Bacteria 3225
778 Ga0157369_10115686 3300013105 Bacteria 2848
779 Ga0171463_1002 3300013249 Bacteria 1274851
780 Ga0157374_10006408 3300013296 Bacteria 9990
781 Ga0157374_10016993 3300013296 Bacteria 6405
782 Ga0157374_10018802 3300013296 Bacteria 6107
783 Ga0157374_10031633 3300013296 Bacteria 4811
784 Ga0157374_10047817 3300013296 Bacteria 3967
785 Ga0157374_10052265 3300013296 Bacteria 3804
786 Ga0157374_10063580 3300013296 Bacteria 3461
787 Ga0157378_10002205 3300013297 Bacteria 17283
788 Ga0157378_10007177 3300013297 Bacteria 9731
789 Ga0157378_10009599 3300013297 Bacteria 8425
790 Ga0157378_10022364 3300013297 Bacteria 5566
791 Ga0157378_10022558 3300013297 Bacteria 5539
792 Ga0157378_10028442 3300013297 Bacteria 4933
793 Ga0163162_10000038 3300013306 Bacteria 138065
794 Ga0163162_10000067 3300013306 Bacteria 99435
795 Ga0163162_10003048 3300013306 Bacteria 16006
796 Ga0163162_10005821 3300013306 Bacteria 11922
797 Ga0163162_10025888 3300013306 Bacteria 5798
798 Ga0163162_10026613 3300013306 Bacteria 5719
799 Ga0163162_10049018 3300013306 Bacteria 4232
800 Ga0163162_10051112 3300013306 Bacteria 4146
801 Ga0163162_10052652 3300013306 Bacteria 4089
802 Ga0163162_10057697 3300013306 Bacteria 3911
803 Ga0157372_10000025 3300013307 Bacteria 195491
804 Ga0157372_10003028 3300013307 Bacteria 18103
805 Ga0157372_10004861 3300013307 Bacteria 14275
806 Ga0157372_10013703 3300013307 Bacteria 8666
807 Ga0157372_10025920 3300013307 Bacteria 6377
808 Ga0157372_10028862 3300013307 Bacteria 6055
809 Ga0157372_10063635 3300013307 Bacteria 4137
810 Ga0157372_10138956 3300013307 Bacteria 2798
811 Ga0157372_10149337 3300013307 Bacteria 2696
812 Ga0157375_10001318 3300013308 Bacteria 21404
813 Ga0157375_10004413 3300013308 Bacteria 12214
814 Ga0157375_10005146 3300013308 Bacteria 11352
815 Ga0157375_10008203 3300013308 Bacteria 9145
816 Ga0157375_10046027 3300013308 Bacteria 4250
817 Ga0157375_10054507 3300013308 Bacteria 3938
818 Ga0157375_10067743 3300013308 Bacteria 3567
819 Ga0157375_10069616 3300013308 Bacteria 3526
820 Ga0157375_10105102 3300013308 Bacteria 2913
821 Ga0163163_10010308 3300014325 Bacteria 8400
822 Ga0163163_10029990 3300014325 Bacteria 5236
823 Ga0163163_10030181 3300014325 Bacteria 5220
824 Ga0163163_10069099 3300014325 Bacteria 3516
825 Ga0163163_10084060 3300014325 Bacteria 3189
826 Ga0163163_10092879 3300014325 Bacteria 3033
827 Ga0157380_10085769 3300014326 Bacteria 2585
828 Ga0182008_10000416 3300014497 Bacteria 33041
829 Ga0182008_10000878 3300014497 Bacteria 20898
830 Ga0182008_10002793 3300014497 Bacteria 10808
831 Ga0182008_10002818 3300014497 Bacteria 10751
832 Ga0182008_10007160 3300014497 Bacteria 6175
833 Ga0157379_10000818 3300014968 Bacteria 25219
834 Ga0157379_10001008 3300014968 Bacteria 22853
835 Ga0157379_10004868 3300014968 Bacteria 11536
836 Ga0157379_10013654 3300014968 Bacteria 7119
837 Ga0157379_10019309 3300014968 Bacteria 6019
838 Ga0157379_10047427 3300014968 Bacteria 3833
839 Ga0157376_10017836 3300014969 Bacteria 5425
840 Ga0157376_10022530 3300014969 Bacteria 4913
841 Ga0157376_10030431 3300014969 Bacteria 4311
842 Ga0157376_10079970 3300014969 Bacteria 2803
843 Ga0182006_1001162 3300015261 Bacteria 16594
844 Ga0182006_1002125 3300015261 Bacteria 11043
845 Ga0182006_1002930 3300015261 Bacteria 9043
846 Ga0182006_1003319 3300015261 Bacteria 8300
847 Ga0182006_1016169 3300015261 Bacteria 3186
848 Ga0182006_1020708 3300015261 Bacteria 2752
849 Ga0182007_10000129 3300015262 Bacteria 53263
850 Ga0182007_10000898 3300015262 Bacteria 16505
851 Ga0182005_1000041 3300015265 Bacteria 150123
852 Ga0182005_1000983 3300015265 Bacteria 12338
853 Ga0182005_1001321 3300015265 Bacteria 10136
854 Ga0182005_1001545 3300015265 Bacteria 9124
855 Ga0182005_1002029 3300015265 Bacteria 7601
856 Ga0182005_1004034 3300015265 Bacteria 4817
857 Ga0183367_1001 3300015688 Bacteria 1225545
858 Ga0183367_1011 3300015688 Bacteria 397353
859 Ga0183360_10001 3300015689 Bacteria 3943671
860 Ga0183363_1005 3300015690 Bacteria 403020
861 Ga0183363_1016 3300015690 Bacteria 67144
862 Ga0163161_10000118 3300017792 Bacteria 75123
863 Ga0163161_10000204 3300017792 Bacteria 54224
864 Ga0163161_10003943 3300017792 Bacteria 10412
865 Ga0163161_10007685 3300017792 Bacteria 7457
866 Ga0163161_10014664 3300017792 Bacteria 5457
867 Ga0197907_10246874 3300020069 Bacteria 2513
868 Ga0197907_10265824 3300020069 Bacteria 5200
869 Ga0197907_10354024 3300020069 Bacteria 3384
870 Ga0197907_10604847 3300020069 Eukaryota 2350
871 Ga0197907_11480787 3300020069 Bacteria 2939
872 Ga0206349_1392433 3300020075 Bacteria 3272
873 Ga0206355_1197704 3300020076 Bacteria 3047
874 Ga0206355_1582971 3300020076 Bacteria 3433
875 Ga0206351_10617994 3300020077 Bacteria 2940
876 Ga0206351_10899598 3300020077 Bacteria 2623
877 Ga0206352_11224536 3300020078 Bacteria 2276
878 Ga0206350_10623975 3300020080 Bacteria 2648
879 Ga0206350_10780144 3300020080 Bacteria 2949
880 Ga0206350_11459509 3300020080 Bacteria 2740
881 Ga0206350_11632907 3300020080 Bacteria 2846
882 Ga0206354_10686772 3300020081 Bacteria 3512
883 Ga0206354_11080053 3300020081 Bacteria 3368
884 Ga0206353_10956205 3300020082 Bacteria 2985
885 Ga0206353_11797530 3300020082 Bacteria 13309
886 Ga0213872_10000007 3300021361 Bacteria 228206
887 Ga0213872_10000009 3300021361 Bacteria 221470
888 Ga0213872_10000294 3300021361 Bacteria 42511
889 Ga0213872_10001640 3300021361 Bacteria 14157
890 Ga0213872_10002442 3300021361 Bacteria 10927
891 Ga0213872_10002518 3300021361 Bacteria 10700
892 Ga0213872_10003221 3300021361 Bacteria 9121
893 Ga0213872_10004311 3300021361 Bacteria 7599
894 Ga0213872_10033137 3300021361 Bacteria 2367
895 Ga0213872_10033236 3300021361 Bacteria 2363
896 Ga0213876_10000044 3300021384 Bacteria 161765
897 Ga0213876_10005060 3300021384 Bacteria 7269
898 Ga0213876_10011078 3300021384 Bacteria 4825
899 Ga0213876_10024216 3300021384 Bacteria 3204
900 Ga0213876_10024547 3300021384 Bacteria 3183
901 Ga0213875_10000001 3300021388 Bacteria 2793540
902 Ga0213875_10012272 3300021388 Bacteria 4238
903 Ga0224712_10005372 3300022467 Bacteria 3560
904 Ga0224712_10007551 3300022467 Bacteria 3171
905 Ga0224712_10007872 3300022467 Bacteria 3123
906 Ga0224712_10008846 3300022467 Bacteria 3006
907 Ga0224712_10011594 3300022467 Bacteria 2741
908 Ga0224712_10013267 3300022467 Eukaryota 2617
909 Ga0224712_10016741 3300022467 Bacteria 2415
910 Ga0224572_1000806 3300024225 Bacteria 4161
911 Ga0228598_1000607 3300024227 Bacteria 7521
912 Ga0228598_1001912 3300024227 Bacteria 4531
913 Ga0209435_100014 3300025206 Bacteria 322129
914 Ga0209435_100025 3300025206 Bacteria 198776
915 Ga0209760_100013 3300025207 Bacteria 181451
916 Ga0209760_100107 3300025207 Bacteria 62762
917 Ga0209436_100004 3300025208 Bacteria 196698
918 Ga0209436_100394 3300025208 Bacteria 19726
919 Ga0209436_100574 3300025208 Bacteria 15760
920 Ga0209784_100005 3300025224 Bacteria 1040422
921 Ga0209566_100005 3300025225 Bacteria 1040422
922 Ga0209674_100009 3300025226 Bacteria 1040422
923 Ga0209674_100067 3300025226 Bacteria 253824
924 Ga0209672_100005 3300025228 Bacteria 1069303
925 Ga0209672_100100 3300025228 Bacteria 108785
926 Ga0209672_104894 3300025228 Bacteria 2391
927 Ga0209563_100012 3300025230 Bacteria 1040422
928 Ga0209563_100023 3300025230 Bacteria 636844
929 Ga0209563_100044 3300025230 Bacteria 396812
930 Ga0209563_100068 3300025230 Bacteria 254802
931 Ga0207427_100003 3300025231 Bacteria 1035004
932 Ga0207427_100011 3300025231 Bacteria 640076
933 Ga0207427_100113 3300025231 Bacteria 107320
934 Ga0207427_100458 3300025231 Bacteria 22530
935 Ga0209437_100002 3300025233 Bacteria 1574801
936 Ga0209437_100010 3300025233 Bacteria 838447
937 Ga0209437_100022 3300025233 Bacteria 625694
938 Ga0209437_100025 3300025233 Bacteria 561333
939 Ga0209258_100006 3300025242 Bacteria 1069303
940 Ga0209258_100024 3300025242 Bacteria 542096
941 Ga0209258_100111 3300025242 Bacteria 197019
942 Ga0209258_100129 3300025242 Bacteria 176515
943 Ga0209258_100891 3300025242 Bacteria 15556
944 Ga0207425_1000161 3300025245 Bacteria 56962
945 Ga0207425_1000177 3300025245 Bacteria 52401
946 Ga0207425_1004810 3300025245 Bacteria 3969
947 Ga0209646_1000001 3300025246 Bacteria 3092932
948 Ga0209646_1000083 3300025246 Bacteria 198777
949 Ga0209646_1000244 3300025246 Bacteria 55661
950 Ga0209026_1000004 3300025250 Bacteria 949012
951 Ga0209026_1000074 3300025250 Bacteria 203820
952 Ga0209026_1000078 3300025250 Bacteria 198777
953 Ga0209026_1000137 3300025250 Bacteria 116282
954 Ga0209026_1000472 3300025250 Bacteria 30801
955 Ga0209026_1003602 3300025250 Bacteria 4986
956 Ga0209026_1004856 3300025250 Bacteria 3816
957 Ga0209677_100006 3300025253 Bacteria 1040422
958 Ga0209677_100049 3300025253 Bacteria 180721
959 Ga0209677_100260 3300025253 Bacteria 35657
960 Ga0209677_101106 3300025253 Bacteria 12670
961 Ga0209148_1000009 3300025254 Bacteria 1395625
962 Ga0209148_1000012 3300025254 Bacteria 1069303
963 Ga0209148_1000078 3300025254 Bacteria 296101
964 Ga0209148_1000099 3300025254 Bacteria 227713
965 Ga0209148_1001201 3300025254 Bacteria 14767
966 Ga0209759_1000003 3300025256 Bacteria 792130
967 Ga0209759_1000013 3300025256 Bacteria 399300
968 Ga0209759_1000060 3300025256 Bacteria 198777
969 Ga0209759_1000110 3300025256 Bacteria 144917
970 Ga0209759_1001172 3300025256 Bacteria 16514
971 Ga0209759_1001705 3300025256 Bacteria 11391
972 Ga0209759_1002076 3300025256 Bacteria 9369
973 Ga0209129_1000060 3300025258 Bacteria 248262
974 Ga0209129_1000226 3300025258 Bacteria 63537
975 Ga0209129_1000861 3300025258 Bacteria 18918
976 Ga0209129_1004906 3300025258 Bacteria 4992
977 Ga0209129_1009710 3300025258 Bacteria 2494
978 Ga0209233_1000004 3300025261 Bacteria 1574798
979 Ga0209233_1000012 3300025261 Bacteria 1019519
980 Ga0209233_1000013 3300025261 Bacteria 1013785
981 Ga0209233_1000017 3300025261 Bacteria 898076
982 Ga0209233_1000031 3300025261 Bacteria 624646
983 Ga0209233_1000146 3300025261 Bacteria 187269
984 Ga0209233_1000975 3300025261 Bacteria 12300
985 Ga0209565_1000001 3300025263 Bacteria 2950419
986 Ga0209565_1000028 3300025263 Bacteria 348536
987 Ga0209565_1002390 3300025263 Bacteria 6812
988 Ga0209565_1003461 3300025263 Bacteria 5091
989 Ga0207666_1000399 3300025271 Bacteria 5721
990 Ga0209455_1000008 3300025272 Bacteria 1069303
991 Ga0209455_1000029 3300025272 Bacteria 542096
992 Ga0209455_1000083 3300025272 Bacteria 255660
993 Ga0209455_1000194 3300025272 Bacteria 89837
994 Ga0209455_1000196 3300025272 Bacteria 88682
995 Ga0209673_1000001 3300025273 Bacteria 3176258
996 Ga0209673_1000035 3300025273 Bacteria 328411
997 Ga0209673_1000239 3300025273 Bacteria 105502
998 Ga0209673_1004737 3300025273 Bacteria 7156
999 Ga0209130_1000001 3300025284 Bacteria 831557
1000 Ga0209130_1000033 3300025284 Bacteria 316064
1001 Ga0209130_1000052 3300025284 Bacteria 216971
1002 Ga0209130_1000118 3300025284 Bacteria 129005
1003 Ga0209130_1001938 3300025284 Bacteria 11500
1004 Ga0209130_1002223 3300025284 Bacteria 10170
1005 Ga0209675_1000001 3300025291 Bacteria 2950293
1006 Ga0209675_1000111 3300025291 Bacteria 114805
1007 Ga0209675_1000291 3300025291 Bacteria 46848
1008 Ga0209675_1003688 3300025291 Bacteria 7148
1009 Ga0209675_1004607 3300025291 Bacteria 6068
1010 Ga0209675_1004636 3300025291 Bacteria 6044
1011 Ga0209676_1000020 3300025292 Bacteria 617256
1012 Ga0209676_1000054 3300025292 Bacteria 365890
1013 Ga0209676_1000059 3300025292 Bacteria 344882
1014 Ga0209676_1000071 3300025292 Bacteria 309464
1015 Ga0209676_1000102 3300025292 Bacteria 227372
1016 Ga0209676_1001068 3300025292 Bacteria 31254
1017 Ga0209025_1000015 3300025294 Bacteria 808120
1018 Ga0209025_1000032 3300025294 Bacteria 416141
1019 Ga0209025_1000086 3300025294 Bacteria 262586
1020 Ga0209025_1000224 3300025294 Bacteria 133328
1021 Ga0209025_1000446 3300025294 Bacteria 80985
1022 Ga0209025_1000447 3300025294 Bacteria 80906
1023 Ga0209025_1000523 3300025294 Bacteria 73071
1024 Ga0209025_1000879 3300025294 Bacteria 47123
1025 Ga0209025_1002317 3300025294 Bacteria 20602
1026 Ga0209025_1003762 3300025294 Bacteria 13903
1027 Ga0209025_1003784 3300025294 Bacteria 13848
1028 Ga0209025_1009138 3300025294 Bacteria 6969
1029 Ga0209564_1000001 3300025295 Bacteria 3176258
1030 Ga0209564_1000087 3300025295 Bacteria 250787
1031 Ga0209564_1000147 3300025295 Bacteria 172628
1032 Ga0209564_1000671 3300025295 Bacteria 50518
1033 Ga0209564_1001181 3300025295 Bacteria 30229
1034 Ga0209564_1001242 3300025295 Bacteria 28585
1035 Ga0209564_1002245 3300025295 Bacteria 15893
1036 Ga0209564_1003175 3300025295 Bacteria 11548
1037 Ga0209564_1005637 3300025295 Bacteria 7038
1038 Ga0209758_1000013 3300025297 Bacteria 873003
1039 Ga0209758_1000130 3300025297 Bacteria 184456
1040 Ga0209758_1000634 3300025297 Bacteria 53757
1041 Ga0209758_1000760 3300025297 Bacteria 46690
1042 Ga0209758_1000856 3300025297 Bacteria 42310
1043 Ga0209758_1001111 3300025297 Bacteria 34637
1044 Ga0209758_1001449 3300025297 Bacteria 27924
1045 Ga0209758_1014694 3300025297 Bacteria 4139
1046 Ga0209758_1023003 3300025297 Bacteria 2834
1047 Ga0209050_1000066 3300025298 Bacteria 305458
1048 Ga0209050_1000105 3300025298 Bacteria 227285
1049 Ga0209050_1000219 3300025298 Bacteria 128416
1050 Ga0209050_1001192 3300025298 Bacteria 30549
1051 Ga0209050_1003009 3300025298 Bacteria 13085
1052 Ga0209050_1003349 3300025298 Bacteria 11943
1053 Ga0209050_1003542 3300025298 Bacteria 11377
1054 Ga0209050_1004443 3300025298 Bacteria 9477
1055 Ga0209050_1006689 3300025298 Bacteria 6747
1056 Ga0209050_1007400 3300025298 Bacteria 6168
1057 Ga0209256_1000002 3300025299 Bacteria 1906740
1058 Ga0209256_1000003 3300025299 Bacteria 1661127
1059 Ga0209256_1000064 3300025299 Bacteria 250853
1060 Ga0209256_1000177 3300025299 Bacteria 125603
1061 Ga0209256_1000326 3300025299 Bacteria 81240
1062 Ga0209256_1000373 3300025299 Bacteria 71879
1063 Ga0209256_1000575 3300025299 Bacteria 52523
1064 Ga0209256_1000812 3300025299 Bacteria 39985
1065 Ga0209256_1001157 3300025299 Bacteria 29830
1066 Ga0209256_1003246 3300025299 Bacteria 11700
1067 Ga0209256_1005541 3300025299 Bacteria 7212
1068 Ga0207426_1000005 3300025302 Bacteria 1037188
1069 Ga0207426_1000078 3300025302 Bacteria 316064
1070 Ga0207426_1000151 3300025302 Bacteria 185103
1071 Ga0207426_1000197 3300025302 Bacteria 146366
1072 Ga0207426_1000396 3300025302 Bacteria 74072
1073 Ga0207426_1002057 3300025302 Bacteria 13996
1074 Ga0207426_1005479 3300025302 Bacteria 5779
1075 Ga0209051_1000021 3300025303 Bacteria 507633
1076 Ga0209051_1000044 3300025303 Bacteria 305458
1077 Ga0209051_1000066 3300025303 Bacteria 227369
1078 Ga0209051_1000511 3300025303 Bacteria 49102
1079 Ga0209051_1000732 3300025303 Bacteria 35565
1080 Ga0209051_1000845 3300025303 Bacteria 31409
1081 Ga0209051_1000955 3300025303 Bacteria 28356
1082 Ga0209051_1002656 3300025303 Bacteria 12504
1083 Ga0209051_1005027 3300025303 Bacteria 7874
1084 Ga0209051_1009862 3300025303 Bacteria 4883
1085 Ga0209257_1000010 3300025304 Bacteria 1158682
1086 Ga0209257_1000055 3300025304 Bacteria 415534
1087 Ga0209257_1000082 3300025304 Bacteria 305458
1088 Ga0209257_1000124 3300025304 Bacteria 218195
1089 Ga0209257_1000347 3300025304 Bacteria 95122
1090 Ga0209257_1000593 3300025304 Bacteria 60449
1091 Ga0209257_1001482 3300025304 Bacteria 27561
1092 Ga0209257_1002346 3300025304 Bacteria 19034
1093 Ga0209257_1002422 3300025304 Bacteria 18635
1094 Ga0209257_1002704 3300025304 Bacteria 16899
1095 Ga0209257_1003444 3300025304 Bacteria 13569
1096 Ga0209257_1003909 3300025304 Bacteria 12125
1097 Ga0209257_1003910 3300025304 Bacteria 12121
1098 Ga0209257_1004374 3300025304 Bacteria 10990
1099 Ga0209257_1004460 3300025304 Bacteria 10837
1100 Ga0209257_1004547 3300025304 Bacteria 10625
1101 Ga0209257_1009180 3300025304 Bacteria 5375
1102 Ga0207697_10005455 3300025315 Bacteria 5912
1103 Ga0207656_10006762 3300025321 Bacteria 4144
1104 Ga0207696_1000016 3300025711 Bacteria 502467
1105 Ga0207696_1000051 3300025711 Bacteria 276833
1106 Ga0207696_1000103 3300025711 Bacteria 165814
1107 Ga0207696_1000548 3300025711 Bacteria 30290
1108 Ga0207696_1003040 3300025711 Bacteria 7829
1109 Ga0207655_1000051 3300025728 Bacteria 294176
1110 Ga0207655_1000080 3300025728 Bacteria 214570
1111 Ga0207655_1000497 3300025728 Bacteria 50628
1112 Ga0207655_1001260 3300025728 Bacteria 24152
1113 Ga0207655_1004155 3300025728 Bacteria 10396
1114 Ga0207713_1000087 3300025735 Bacteria 157009
1115 Ga0207713_1000199 3300025735 Bacteria 83023
1116 Ga0207713_1002190 3300025735 Bacteria 14490
1117 Ga0207713_1002994 3300025735 Bacteria 11808
1118 Ga0207713_1007237 3300025735 Bacteria 6594
1119 Ga0207713_1009463 3300025735 Bacteria 5489
1120 Ga0207713_1012694 3300025735 Bacteria 4484
1121 Ga0207682_10000414 3300025893 Bacteria 19591
1122 Ga0207692_10007812 3300025898 Bacteria 4399
1123 Ga0207692_10008574 3300025898 Bacteria 4237
1124 Ga0207692_10023110 3300025898 Bacteria 2871
1125 Ga0207642_10014229 3300025899 Bacteria 2930
1126 Ga0207710_10000286 3300025900 Bacteria 40875
1127 Ga0207710_10006680 3300025900 Bacteria 4916
1128 Ga0207710_10009564 3300025900 Bacteria 4076
1129 Ga0207688_10021256 3300025901 Bacteria 3545
1130 Ga0207688_10021676 3300025901 Bacteria 3513
1131 Ga0207688_10023595 3300025901 Bacteria 3370
1132 Ga0207680_10005760 3300025903 Bacteria 5943
1133 Ga0207647_10000210 3300025904 Bacteria 47384
1134 Ga0207647_10000720 3300025904 Bacteria 25922
1135 Ga0207647_10001799 3300025904 Bacteria 16429
1136 Ga0207647_10003487 3300025904 Bacteria 11791
1137 Ga0207647_10006330 3300025904 Bacteria 8612
1138 Ga0207647_10026081 3300025904 Bacteria 3827
1139 Ga0207647_10043559 3300025904 Bacteria 2808
1140 Ga0207685_10000387 3300025905 Bacteria 7248
1141 Ga0207699_10001430 3300025906 Bacteria 11324
1142 Ga0207699_10005406 3300025906 Bacteria 6120
1143 Ga0207699_10032810 3300025906 Bacteria 2929
1144 Ga0207645_10000168 3300025907 Bacteria 52201
1145 Ga0207645_10000682 3300025907 Bacteria 28134
1146 Ga0207645_10002229 3300025907 Bacteria 15452
1147 Ga0207645_10010229 3300025907 Bacteria 6448
1148 Ga0207645_10040044 3300025907 Bacteria 3001
1149 Ga0207643_10015268 3300025908 Bacteria 4178
1150 Ga0207643_10018676 3300025908 Bacteria 3797
1151 Ga0207643_10023177 3300025908 Bacteria 3423
1152 Ga0207705_10004586 3300025909 Bacteria 10437
1153 Ga0207705_10005000 3300025909 Bacteria 9949
1154 Ga0207705_10006256 3300025909 Bacteria 8843
1155 Ga0207705_10015414 3300025909 Bacteria 5485
1156 Ga0207705_10046973 3300025909 Bacteria 3104
1157 Ga0207684_10000408 3300025910 Bacteria 57555
1158 Ga0207684_10001773 3300025910 Bacteria 22776
1159 Ga0207684_10014461 3300025910 Bacteria 6804
1160 Ga0207684_10017361 3300025910 Bacteria 6174
1161 Ga0207684_10021772 3300025910 Bacteria 5473
1162 Ga0207684_10085867 3300025910 Bacteria 2680
1163 Ga0207654_10000011 3300025911 Bacteria 245470
1164 Ga0207707_10008910 3300025912 Bacteria 8713
1165 Ga0207707_10027852 3300025912 Bacteria 4941
1166 Ga0207707_10048503 3300025912 Bacteria 3699
1167 Ga0207695_10000055 3300025913 Bacteria 382776
1168 Ga0207695_10000110 3300025913 Bacteria 250079
1169 Ga0207695_10000120 3300025913 Bacteria 234247
1170 Ga0207695_10000193 3300025913 Bacteria 172070
1171 Ga0207695_10000244 3300025913 Bacteria 141138
1172 Ga0207695_10000422 3300025913 Bacteria 93814
1173 Ga0207695_10000573 3300025913 Bacteria 75332
1174 Ga0207695_10000699 3300025913 Bacteria 65747
1175 Ga0207695_10005405 3300025913 Bacteria 16962
1176 Ga0207695_10008626 3300025913 Bacteria 12733
1177 Ga0207695_10018747 3300025913 Bacteria 7989
1178 Ga0207695_10030747 3300025913 Bacteria 5908
1179 Ga0207695_10033882 3300025913 Bacteria 5561
1180 Ga0207695_10051167 3300025913 Bacteria 4340
1181 Ga0207695_10060724 3300025913 Bacteria 3911
1182 Ga0207695_10084490 3300025913 Bacteria 3205
1183 Ga0207695_10127069 3300025913 Bacteria 2510
1184 Ga0207671_10000023 3300025914 Bacteria 274756
1185 Ga0207671_10005289 3300025914 Bacteria 11964
1186 Ga0207671_10048302 3300025914 Bacteria 3150
1187 Ga0207671_10080222 3300025914 Bacteria 2446
1188 Ga0207693_10002335 3300025915 Bacteria 16489
1189 Ga0207693_10003454 3300025915 Bacteria 13481
1190 Ga0207693_10003791 3300025915 Bacteria 12876
1191 Ga0207693_10028938 3300025915 Bacteria 4379
1192 Ga0207693_10031079 3300025915 Bacteria 4219
1193 Ga0207663_10018178 3300025916 Bacteria 3934
1194 Ga0207660_10038651 3300025917 Bacteria 3332
1195 Ga0207662_10005289 3300025918 Bacteria 6860
1196 Ga0207662_10008678 3300025918 Bacteria 5574
1197 Ga0207662_10014907 3300025918 Bacteria 4366
1198 Ga0207657_10001230 3300025919 Bacteria 27346
1199 Ga0207657_10003524 3300025919 Bacteria 16714
1200 Ga0207657_10007575 3300025919 Bacteria 11128
1201 Ga0207657_10011638 3300025919 Bacteria 8723
1202 Ga0207657_10041457 3300025919 Bacteria 4070
1203 Ga0207657_10044844 3300025919 Bacteria 3884
1204 Ga0207657_10045741 3300025919 Bacteria 3838
1205 Ga0207657_10058278 3300025919 Bacteria 3324
1206 Ga0207657_10060856 3300025919 Bacteria 3240
1207 Ga0207652_10000328 3300025921 Bacteria 49143
1208 Ga0207652_10009089 3300025921 Bacteria 8003
1209 Ga0207652_10019382 3300025921 Bacteria 5594
1210 Ga0207652_10054874 3300025921 Bacteria 3426
1211 Ga0207646_10000056 3300025922 Bacteria 158385
1212 Ga0207646_10004705 3300025922 Bacteria 14712
1213 Ga0207646_10010105 3300025922 Bacteria 9247
1214 Ga0207646_10011399 3300025922 Bacteria 8620
1215 Ga0207646_10024672 3300025922 Bacteria 5506
1216 Ga0207646_10061335 3300025922 Bacteria 3357
1217 Ga0207646_10063087 3300025922 Bacteria 3308
1218 Ga0207646_10091948 3300025922 Bacteria 2715
1219 Ga0207681_10002122 3300025923 Bacteria 12692
1220 Ga0207681_10008445 3300025923 Bacteria 6295
1221 Ga0207681_10014176 3300025923 Bacteria 4947
1222 Ga0207681_10015921 3300025923 Bacteria 4695
1223 Ga0207681_10018391 3300025923 Bacteria 4403
1224 Ga0207681_10028155 3300025923 Bacteria 3638
1225 Ga0207694_10000505 3300025924 Bacteria 35291
1226 Ga0207694_10000692 3300025924 Bacteria 30286
1227 Ga0207694_10007696 3300025924 Bacteria 8163
1228 Ga0207694_10021655 3300025924 Bacteria 4871
1229 Ga0207694_10046636 3300025924 Bacteria 3350
1230 Ga0207694_10080797 3300025924 Bacteria 2552
1231 Ga0207650_10001797 3300025925 Bacteria 15158
1232 Ga0207650_10006071 3300025925 Bacteria 8240
1233 Ga0207650_10021131 3300025925 Bacteria 4600
1234 Ga0207650_10091198 3300025925 Bacteria 2328
1235 Ga0207659_10001249 3300025926 Bacteria 15242
1236 Ga0207659_10006421 3300025926 Bacteria 7202
1237 Ga0207659_10010648 3300025926 Bacteria 5783
1238 Ga0207659_10019505 3300025926 Bacteria 4466
1239 Ga0207659_10028885 3300025926 Bacteria 3773
1240 Ga0207687_10000604 3300025927 Bacteria 24253
1241 Ga0207687_10022151 3300025927 Bacteria 4226
1242 Ga0207687_10023489 3300025927 Bacteria 4111
1243 Ga0207687_10033044 3300025927 Bacteria 3508
1244 Ga0207687_10054800 3300025927 Bacteria 2791
1245 Ga0207700_10000144 3300025928 Bacteria 42612
1246 Ga0207700_10001951 3300025928 Bacteria 11735
1247 Ga0207700_10027138 3300025928 Bacteria 4005
1248 Ga0207700_10061532 3300025928 Bacteria 2848
1249 Ga0207700_10062854 3300025928 Bacteria 2821
1250 Ga0207700_10071621 3300025928 Bacteria 2670
1251 Ga0207664_10000003 3300025929 Bacteria 510966
1252 Ga0207664_10000121 3300025929 Bacteria 68207
1253 Ga0207664_10000127 3300025929 Bacteria 66344
1254 Ga0207664_10000600 3300025929 Bacteria 24938
1255 Ga0207664_10028796 3300025929 Bacteria 4224
1256 Ga0207664_10046745 3300025929 Bacteria 3399
1257 Ga0207664_10080016 3300025929 Bacteria 2655
1258 Ga0207644_10002833 3300025931 Bacteria 11181
1259 Ga0207644_10004011 3300025931 Bacteria 9558
1260 Ga0207644_10021746 3300025931 Bacteria 4374
1261 Ga0207644_10026809 3300025931 Bacteria 3976
1262 Ga0207644_10028283 3300025931 Bacteria 3879
1263 Ga0207690_10000041 3300025932 Bacteria 125863
1264 Ga0207690_10007513 3300025932 Bacteria 6468
1265 Ga0207690_10041278 3300025932 Bacteria 3022
1266 Ga0207690_10050982 3300025932 Bacteria 2765
1267 Ga0207706_10001233 3300025933 Bacteria 25812
1268 Ga0207706_10002666 3300025933 Bacteria 17381
1269 Ga0207706_10009306 3300025933 Bacteria 9019
1270 Ga0207706_10014783 3300025933 Bacteria 7066
1271 Ga0207686_10011026 3300025934 Bacteria 4934
1272 Ga0207686_10021709 3300025934 Bacteria 3688
1273 Ga0207686_10033684 3300025934 Bacteria 3059
1274 Ga0207709_10000011 3300025935 Bacteria 552881
1275 Ga0207709_10000038 3300025935 Bacteria 266638
1276 Ga0207709_10050858 3300025935 Bacteria 2537
1277 Ga0207670_10081165 3300025936 Bacteria 2269
1278 Ga0207669_10001951 3300025937 Bacteria 8747
1279 Ga0207669_10005640 3300025937 Bacteria 5642
1280 Ga0207669_10006284 3300025937 Bacteria 5414
1281 Ga0207704_10003009 3300025938 Bacteria 7627
1282 Ga0207704_10008207 3300025938 Bacteria 4976
1283 Ga0207704_10021966 3300025938 Bacteria 3410
1284 Ga0207665_10000523 3300025939 Bacteria 25887
1285 Ga0207665_10002828 3300025939 Bacteria 11640
1286 Ga0207665_10004516 3300025939 Bacteria 9229
1287 Ga0207665_10021336 3300025939 Bacteria 4259
1288 Ga0207665_10024729 3300025939 Bacteria 3961
1289 Ga0207665_10075515 3300025939 Bacteria 2309
1290 Ga0207691_10000186 3300025940 Bacteria 58949
1291 Ga0207691_10003047 3300025940 Bacteria 16343
1292 Ga0207691_10003099 3300025940 Bacteria 16230
1293 Ga0207691_10007820 3300025940 Bacteria 10295
1294 Ga0207691_10010363 3300025940 Bacteria 8940
1295 Ga0207691_10018372 3300025940 Bacteria 6624
1296 Ga0207691_10019616 3300025940 Bacteria 6398
1297 Ga0207691_10023608 3300025940 Bacteria 5791
1298 Ga0207691_10032352 3300025940 Bacteria 4877
1299 Ga0207691_10055267 3300025940 Bacteria 3618
1300 Ga0207711_10000409 3300025941 Bacteria 45554
1301 Ga0207711_10010354 3300025941 Bacteria 7746
1302 Ga0207711_10011306 3300025941 Bacteria 7416
1303 Ga0207711_10011447 3300025941 Bacteria 7375
1304 Ga0207711_10024439 3300025941 Bacteria 5062
1305 Ga0207711_10058807 3300025941 Bacteria 3309
1306 Ga0207711_10072629 3300025941 Bacteria 2989
1307 Ga0207689_10005308 3300025942 Bacteria 11545
1308 Ga0207689_10005887 3300025942 Bacteria 10861
1309 Ga0207689_10009946 3300025942 Bacteria 8204
1310 Ga0207689_10010043 3300025942 Bacteria 8158
1311 Ga0207689_10013537 3300025942 Bacteria 6964
1312 Ga0207689_10019434 3300025942 Bacteria 5727
1313 Ga0207689_10022087 3300025942 Bacteria 5351
1314 Ga0207661_10000033 3300025944 Bacteria 156468
1315 Ga0207661_10001439 3300025944 Bacteria 16052
1316 Ga0207661_10002341 3300025944 Bacteria 13050
1317 Ga0207661_10007698 3300025944 Bacteria 7665
1318 Ga0207661_10008000 3300025944 Bacteria 7539
1319 Ga0207661_10013671 3300025944 Bacteria 5926
1320 Ga0207661_10016885 3300025944 Bacteria 5391
1321 Ga0207661_10018909 3300025944 Bacteria 5128
1322 Ga0207661_10025887 3300025944 Bacteria 4464
1323 Ga0207679_10032517 3300025945 Bacteria 3663
1324 Ga0207667_10000053 3300025949 Bacteria 226712
1325 Ga0207667_10000077 3300025949 Bacteria 166095
1326 Ga0207667_10000082 3300025949 Bacteria 157749
1327 Ga0207667_10001623 3300025949 Bacteria 28293
1328 Ga0207667_10003300 3300025949 Bacteria 19910
1329 Ga0207667_10009695 3300025949 Bacteria 11327
1330 Ga0207667_10013523 3300025949 Bacteria 9332
1331 Ga0207667_10014678 3300025949 Bacteria 8918
1332 Ga0207667_10017152 3300025949 Bacteria 8163
1333 Ga0207667_10036276 3300025949 Bacteria 5285
1334 Ga0207667_10135932 3300025949 Bacteria 2531
1335 Ga0207651_10021587 3300025960 Bacteria 3917
1336 Ga0207651_10025070 3300025960 Bacteria 3701
1337 Ga0207651_10046299 3300025960 Bacteria 2924
1338 Ga0207712_10000320 3300025961 Bacteria 43861
1339 Ga0207712_10008144 3300025961 Bacteria 6630
1340 Ga0207712_10035781 3300025961 Bacteria 3377
1341 Ga0207712_10037545 3300025961 Bacteria 3306
1342 Ga0207712_10056977 3300025961 Bacteria 2755
1343 Ga0207668_10006186 3300025972 Bacteria 7064
1344 Ga0207668_10008260 3300025972 Bacteria 6202
1345 Ga0207668_10030968 3300025972 Bacteria 3520
1346 Ga0207668_10034351 3300025972 Bacteria 3367
1347 Ga0207640_10000032 3300025981 Bacteria 116582
1348 Ga0207640_10000747 3300025981 Bacteria 18669
1349 Ga0207640_10033425 3300025981 Bacteria 3200
1350 Ga0207658_10000927 3300025986 Bacteria 24275
1351 Ga0207658_10001058 3300025986 Bacteria 22307
1352 Ga0207658_10005237 3300025986 Bacteria 8923
1353 Ga0207658_10014146 3300025986 Bacteria 5465
1354 Ga0207658_10048498 3300025986 Bacteria 3114
1355 Ga0207658_10056932 3300025986 Bacteria 2903
1356 Ga0207658_10072029 3300025986 Bacteria 2618
1357 Ga0207658_10097805 3300025986 Bacteria 2292
1358 Ga0207703_10000001 3300026035 Bacteria 822925
1359 Ga0207703_10000728 3300026035 Bacteria 32331
1360 Ga0207703_10003865 3300026035 Bacteria 12451
1361 Ga0207703_10006001 3300026035 Bacteria 9729
1362 Ga0207703_10007605 3300026035 Bacteria 8591
1363 Ga0207703_10036520 3300026035 Bacteria 3912
1364 Ga0207703_10045844 3300026035 Bacteria 3518
1365 Ga0207703_10052196 3300026035 Bacteria 3318
1366 Ga0207703_10102324 3300026035 Bacteria 2430
1367 Ga0207639_10000005 3300026041 Bacteria 579948
1368 Ga0207639_10002503 3300026041 Bacteria 12320
1369 Ga0207639_10004093 3300026041 Bacteria 9833
1370 Ga0207639_10035057 3300026041 Bacteria 3712
1371 Ga0207639_10079774 3300026041 Bacteria 2588
1372 Ga0207678_10000179 3300026067 Bacteria 54141
1373 Ga0207678_10007559 3300026067 Bacteria 9604
1374 Ga0207678_10011859 3300026067 Bacteria 7652
1375 Ga0207678_10012130 3300026067 Bacteria 7568
1376 Ga0207678_10025712 3300026067 Bacteria 5138
1377 Ga0207678_10043302 3300026067 Bacteria 3895
1378 Ga0207708_10000006 3300026075 Bacteria 266916
1379 Ga0207708_10005144 3300026075 Bacteria 9649
1380 Ga0207708_10006680 3300026075 Bacteria 8532
1381 Ga0207708_10012001 3300026075 Bacteria 6456
1382 Ga0207708_10033201 3300026075 Bacteria 3919
1383 Ga0207702_10000525 3300026078 Bacteria 42984
1384 Ga0207702_10006743 3300026078 Bacteria 9858
1385 Ga0207702_10008941 3300026078 Bacteria 8446
1386 Ga0207702_10067333 3300026078 Bacteria 3073
1387 Ga0207641_10000217 3300026088 Bacteria 74684
1388 Ga0207641_10028840 3300026088 Bacteria 4588
1389 Ga0207641_10088471 3300026088 Bacteria 2704
1390 Ga0207648_10002813 3300026089 Bacteria 18446
1391 Ga0207648_10003810 3300026089 Bacteria 15766
1392 Ga0207648_10007234 3300026089 Bacteria 10944
1393 Ga0207648_10008327 3300026089 Bacteria 10060
1394 Ga0207648_10013011 3300026089 Bacteria 7763
1395 Ga0207648_10018249 3300026089 Bacteria 6355
1396 Ga0207648_10020830 3300026089 Bacteria 5904
1397 Ga0207648_10026339 3300026089 Bacteria 5169
1398 Ga0207648_10084681 3300026089 Bacteria 2765
1399 Ga0207676_10009489 3300026095 Bacteria 6926
1400 Ga0207676_10015070 3300026095 Bacteria 5574
1401 Ga0207676_10023159 3300026095 Bacteria 4577
1402 Ga0207676_10053534 3300026095 Bacteria 3159
1403 Ga0207676_10073295 3300026095 Bacteria 2755
1404 Ga0207674_10007884 3300026116 Bacteria 12371
1405 Ga0207674_10008783 3300026116 Bacteria 11635
1406 Ga0207674_10016151 3300026116 Bacteria 8180
1407 Ga0207674_10030951 3300026116 Bacteria 5624
1408 Ga0207674_10031424 3300026116 Bacteria 5579
1409 Ga0207674_10045540 3300026116 Bacteria 4511
1410 Ga0207674_10069985 3300026116 Bacteria 3527
1411 Ga0207675_100000055 3300026118 Bacteria 82106
1412 Ga0207675_100007771 3300026118 Bacteria 10117
1413 Ga0207675_100011656 3300026118 Bacteria 8222
1414 Ga0207675_100024613 3300026118 Bacteria 5597
1415 Ga0207675_100030431 3300026118 Bacteria 5028
1416 Ga0207683_10000339 3300026121 Bacteria 42571
1417 Ga0207683_10002436 3300026121 Bacteria 16229
1418 Ga0207683_10002776 3300026121 Bacteria 15304
1419 Ga0207683_10004717 3300026121 Bacteria 11747
1420 Ga0207683_10008428 3300026121 Bacteria 8824
1421 Ga0207683_10013088 3300026121 Bacteria 7076
1422 Ga0207683_10020543 3300026121 Bacteria 5650
1423 Ga0207683_10022357 3300026121 Bacteria 5427
1424 Ga0207683_10028952 3300026121 Bacteria 4793
1425 Ga0207683_10039345 3300026121 Bacteria 4125
1426 Ga0207683_10045873 3300026121 Bacteria 3822
1427 Ga0207698_10001920 3300026142 Bacteria 12187
1428 Ga0207698_10009748 3300026142 Bacteria 6134
1429 Ga0207698_10040178 3300026142 Bacteria 3473
1430 Ga0207698_10075403 3300026142 Bacteria 2695
1431 Ga0209281_1000567 3300027111 Bacteria 44500
1432 Ga0209281_1002352 3300027111 Bacteria 7794
1433 Ga0209389_1000042 3300027296 Bacteria 123281
1434 Ga0209389_1004076 3300027296 Bacteria 12023
1435 Ga0209371_1005052 3300027312 Bacteria 5426
1436 Ga0209282_1000078 3300027666 Bacteria 76811
1437 Ga0209966_1000111 3300027695 Bacteria 36041
1438 Ga0209966_1000862 3300027695 Bacteria 5894
1439 Ga0209813_10000377 3300027866 Bacteria 11186
1440 Ga0209813_10003436 3300027866 Bacteria 3707
1441 Ga0209974_10011857 3300027876 Bacteria 2921
1442 Ga0207428_10000001 3300027907 Bacteria 1034622
1443 Ga0207428_10002582 3300027907 Bacteria 18087
1444 Ga0207428_10004979 3300027907 Bacteria 12508
1445 Ga0207428_10017461 3300027907 Bacteria 6158
1446 Ga0207428_10040825 3300027907 Bacteria 3759
1447 Ga0207428_10048325 3300027907 Bacteria 3414
1448 Ga0268266_10000007 3300028379 Bacteria 1372921
1449 Ga0268266_10000016 3300028379 Bacteria 629101
1450 Ga0268266_10000813 3300028379 Bacteria 41102
1451 Ga0268266_10003267 3300028379 Bacteria 16326
1452 Ga0268266_10015175 3300028379 Bacteria 6614
1453 Ga0268266_10028593 3300028379 Bacteria 4737
1454 Ga0268266_10031278 3300028379 Bacteria 4518
1455 Ga0268266_10074052 3300028379 Bacteria 2957
1456 Ga0268265_10008131 3300028380 Bacteria 7089
1457 Ga0268265_10011713 3300028380 Bacteria 5930
1458 Ga0268265_10020761 3300028380 Bacteria 4590
1459 Ga0268265_10021243 3300028380 Bacteria 4544
1460 Ga0268265_10038200 3300028380 Bacteria 3530
1461 Ga0268265_10080083 3300028380 Bacteria 2575
1462 Ga0268264_10000058 3300028381 Bacteria 308956
1463 Ga0268264_10000060 3300028381 Bacteria 305056
1464 Ga0268264_10000072 3300028381 Bacteria 260791
1465 Ga0268264_10000227 3300028381 Bacteria 109454
1466 Ga0268264_10000320 3300028381 Bacteria 75931
1467 Ga0268264_10015499 3300028381 Bacteria 6248
1468 Ga0268264_10016398 3300028381 Bacteria 6064
1469 Ga0268264_10025553 3300028381 Bacteria 4825
1470 Ga0268264_10032454 3300028381 Bacteria 4285
1471 Ga0268264_10073881 3300028381 Bacteria 2895
1472 Ga0268264_10093780 3300028381 Bacteria 2594
1473 Ga0265337_1000089 3300028556 Bacteria 44667
1474 Ga0265337_1001912 3300028556 Bacteria 9912
1475 Ga0265337_1002082 3300028556 Bacteria 9459
1476 Ga0265326_10005997 3300028558 Bacteria 3803
1477 Ga0265319_1000326 3300028563 Bacteria 35093
1478 Ga0265319_1001250 3300028563 Bacteria 15514
1479 Ga0265319_1002294 3300028563 Bacteria 10554
1480 Ga0265319_1005146 3300028563 Bacteria 6327
1481 Ga0265334_10000611 3300028573 Bacteria 17975
1482 Ga0265334_10000988 3300028573 Bacteria 14096
1483 Ga0265334_10001152 3300028573 Bacteria 12925
1484 Ga0265334_10001920 3300028573 Bacteria 9868
1485 Ga0265318_10000320 3300028577 Bacteria 38387
1486 Ga0265318_10000462 3300028577 Bacteria 30300
1487 Ga0265318_10001882 3300028577 Bacteria 11784
1488 Ga0265318_10004511 3300028577 Bacteria 6734
1489 Ga0265323_10000943 3300028653 Bacteria 15268
1490 Ga0265322_10000083 3300028654 Bacteria 44679
1491 Ga0265336_10000087 3300028666 Bacteria 72636
1492 Ga0265336_10000211 3300028666 Bacteria 40984
1493 Ga0265336_10000287 3300028666 Bacteria 34809
1494 Ga0265336_10006858 3300028666 Bacteria 4078
1495 Ga0265336_10007251 3300028666 Bacteria 3948
1496 Ga0307517_10000463 3300028786 Bacteria 69565
1497 Ga0307517_10008151 3300028786 Bacteria 15069
1498 Ga0307517_10066418 3300028786 Bacteria 3319
1499 Ga0307517_10081510 3300028786 Bacteria 2757
1500 Ga0307515_10000001 3300028794 Bacteria 4259510
1501 Ga0307515_10000013 3300028794 Bacteria 568456
1502 Ga0307515_10000025 3300028794 Bacteria 390205
1503 Ga0307515_10000041 3300028794 Bacteria 319110
1504 Ga0307515_10000048 3300028794 Bacteria 288111
1505 Ga0307515_10000154 3300028794 Bacteria 166582
1506 Ga0307515_10000459 3300028794 Bacteria 97482
1507 Ga0307515_10000486 3300028794 Bacteria 94816
1508 Ga0307515_10001559 3300028794 Bacteria 51153
1509 Ga0307515_10003221 3300028794 Bacteria 34544
1510 Ga0307515_10005985 3300028794 Bacteria 24500
1511 Ga0307515_10007036 3300028794 Bacteria 22346
1512 Ga0307515_10032140 3300028794 Bacteria 8709
1513 Ga0307515_10050447 3300028794 Eukaryota 6231
1514 Ga0307515_10060754 3300028794 Bacteria 5381
1515 Ga0307515_10070109 3300028794 Bacteria 4777
1516 Ga0307515_10082625 3300028794 Bacteria 4151
1517 Ga0307515_10095702 3300028794 Bacteria 3651
1518 Ga0265338_10000081 3300028800 Bacteria 176402
1519 Ga0265338_10000691 3300028800 Bacteria 57964
1520 Ga0265338_10001887 3300028800 Bacteria 32808
1521 Ga0265338_10001991 3300028800 Bacteria 31759
1522 Ga0265338_10002478 3300028800 Bacteria 27582
1523 Ga0265338_10002823 3300028800 Bacteria 25367
1524 Ga0265338_10003841 3300028800 Bacteria 20854
1525 Ga0265338_10004581 3300028800 Bacteria 18590
1526 Ga0265338_10007083 3300028800 Bacteria 14057
1527 Ga0265338_10007975 3300028800 Bacteria 12962
1528 Ga0265338_10013392 3300028800 Bacteria 9264
1529 Ga0265338_10019945 3300028800 Bacteria 7078
1530 Ga0265338_10022004 3300028800 Bacteria 6624
1531 Ga0265338_10022705 3300028800 Bacteria 6480
1532 Ga0265338_10028855 3300028800 Bacteria 5521
1533 Ga0265338_10050672 3300028800 Bacteria 3749
1534 Ga0265338_10095320 3300028800 Bacteria 2445
1535 Ga0265324_10000006 3300029957 Bacteria 267048
1536 Ga0265324_10000334 3300029957 Bacteria 34717
1537 Ga0265324_10003068 3300029957 Bacteria 8149
1538 Ga0265324_10012386 3300029957 Bacteria 3216
1539 Ga0268256_1007398 3300030500 Bacteria 3926
1540 Ga0307511_10000247 3300030521 Bacteria 55370
1541 Ga0307511_10000444 3300030521 Bacteria 44383
1542 Ga0307511_10036457 3300030521 Bacteria 4269
1543 Ga0307512_10005187 3300030522 Bacteria 13737
1544 Ga0307512_10020785 3300030522 Bacteria 5931
1545 Ga0307512_10081124 3300030522 Bacteria 2329
1546 Ga0316176_1130274 3300030732 Bacteria 4003
1547 Ga0316180_1114296 3300030736 Bacteria 3954
1548 Ga0316181_1007874 3300030744 Bacteria 3684
1549 Ga0316182_1025613 3300030745 Bacteria 6393
1550 Ga0265762_1002651 3300030760 Bacteria 3210
1551 Ga0265760_10000248 3300031090 Bacteria 14820
1552 Ga0265760_10000332 3300031090 Bacteria 13238
1553 Ga0265760_10000358 3300031090 Bacteria 12795
1554 Ga0265760_10000410 3300031090 Bacteria 12022
1555 Ga0265330_10000784 3300031235 Bacteria 19996
1556 Ga0265330_10001427 3300031235 Bacteria 13947
1557 Ga0265330_10001746 3300031235 Bacteria 12227
1558 Ga0265330_10002244 3300031235 Bacteria 10648
1559 Ga0265330_10011194 3300031235 Bacteria 4212
1560 Ga0265330_10023167 3300031235 Bacteria 2822
1561 Ga0265332_10000014 3300031238 Bacteria 249035
1562 Ga0265332_10000591 3300031238 Bacteria 23837
1563 Ga0265332_10000715 3300031238 Bacteria 20998
1564 Ga0265332_10000787 3300031238 Bacteria 19301
1565 Ga0265332_10009209 3300031238 Bacteria 4415
1566 Ga0265332_10015209 3300031238 Bacteria 3399
1567 Ga0265332_10019555 3300031238 Bacteria 2989
1568 Ga0265332_10019852 3300031238 Bacteria 2966
1569 Ga0265328_10004390 3300031239 Bacteria 6130
1570 Ga0265328_10005324 3300031239 Bacteria 5524
1571 Ga0265328_10007575 3300031239 Bacteria 4522
1572 Ga0265320_10001105 3300031240 Bacteria 19923
1573 Ga0265320_10001453 3300031240 Bacteria 17277
1574 Ga0265320_10004309 3300031240 Bacteria 9353
1575 Ga0265320_10006412 3300031240 Bacteria 7417
1576 Ga0265320_10010585 3300031240 Bacteria 5483
1577 Ga0265325_10000057 3300031241 Bacteria 77333
1578 Ga0265325_10000090 3300031241 Bacteria 64219
1579 Ga0265325_10000171 3300031241 Bacteria 45980
1580 Ga0265325_10001865 3300031241 Bacteria 14560
1581 Ga0265325_10009232 3300031241 Bacteria 5767
1582 Ga0265329_10000050 3300031242 Bacteria 51098
1583 Ga0265329_10001723 3300031242 Bacteria 10460
1584 Ga0265329_10004705 3300031242 Bacteria 5624
1585 Ga0265340_10001347 3300031247 Bacteria 14085
1586 Ga0265340_10001481 3300031247 Bacteria 13464
1587 Ga0265340_10001562 3300031247 Bacteria 13158
1588 Ga0265340_10005284 3300031247 Bacteria 7170
1589 Ga0265340_10006434 3300031247 Bacteria 6467
1590 Ga0265340_10007396 3300031247 Bacteria 5963
1591 Ga0265340_10010721 3300031247 Bacteria 4896
1592 Ga0265340_10010740 3300031247 Bacteria 4892
1593 Ga0265340_10011303 3300031247 Bacteria 4749
1594 Ga0265340_10011533 3300031247 Bacteria 4696
1595 Ga0265340_10016444 3300031247 Bacteria 3831
1596 Ga0265339_10000003 3300031249 Bacteria 305994
1597 Ga0265339_10000409 3300031249 Bacteria 33837
1598 Ga0265339_10001817 3300031249 Bacteria 15650
1599 Ga0265339_10002198 3300031249 Bacteria 14156
1600 Ga0265339_10005831 3300031249 Bacteria 8167
1601 Ga0265339_10007035 3300031249 Bacteria 7304
1602 Ga0265339_10007187 3300031249 Bacteria 7218
1603 Ga0265339_10009328 3300031249 Bacteria 6174
1604 Ga0265339_10011602 3300031249 Bacteria 5414
1605 Ga0265339_10017438 3300031249 Bacteria 4254
1606 Ga0265331_10000018 3300031250 Bacteria 264804
1607 Ga0265331_10000135 3300031250 Bacteria 96750
1608 Ga0265331_10000462 3300031250 Bacteria 39087
1609 Ga0265331_10000772 3300031250 Bacteria 26658
1610 Ga0265331_10000918 3300031250 Bacteria 23615
1611 Ga0265331_10000995 3300031250 Bacteria 22259
1612 Ga0265331_10029138 3300031250 Bacteria 2757
1613 Ga0265327_10000009 3300031251 Bacteria 616360
1614 Ga0265327_10000053 3300031251 Bacteria 255002
1615 Ga0265327_10000167 3300031251 Bacteria 141405
1616 Ga0265327_10000395 3300031251 Bacteria 81944
1617 Ga0265327_10002336 3300031251 Bacteria 20231
1618 Ga0265327_10002544 3300031251 Bacteria 18974
1619 Ga0265327_10003367 3300031251 Bacteria 15396
1620 Ga0265327_10009856 3300031251 Bacteria 6820
1621 Ga0265327_10011154 3300031251 Bacteria 6230
1622 Ga0265327_10018536 3300031251 Bacteria 4310
1623 Ga0265316_10000018 3300031344 Bacteria 195092
1624 Ga0265316_10000531 3300031344 Bacteria 42984
1625 Ga0265316_10000894 3300031344 Bacteria 32622
1626 Ga0265316_10001399 3300031344 Bacteria 25955
1627 Ga0265316_10002273 3300031344 Bacteria 20130
1628 Ga0265316_10002344 3300031344 Bacteria 19745
1629 Ga0265316_10004704 3300031344 Bacteria 13525
1630 Ga0265316_10006329 3300031344 Bacteria 11328
1631 Ga0265316_10010854 3300031344 Bacteria 8271
1632 Ga0265316_10023783 3300031344 Bacteria 5144
1633 Ga0265316_10038432 3300031344 Bacteria 3856
1634 Ga0265316_10039697 3300031344 Bacteria 3779
1635 Ga0265316_10044234 3300031344 Bacteria 3543
1636 Ga0265316_10059083 3300031344 Bacteria 2983
1637 Ga0307513_10001044 3300031456 Bacteria 40198
1638 Ga0307513_10005286 3300031456 Bacteria 17089
1639 Ga0307513_10008631 3300031456 Bacteria 12991
1640 Ga0307513_10009082 3300031456 Bacteria 12604
1641 Ga0307513_10019288 3300031456 Bacteria 8121
1642 Ga0307513_10035630 3300031456 Bacteria 5564
1643 Ga0307513_10035720 3300031456 Bacteria 5556
1644 Ga0307513_10064738 3300031456 Bacteria 3850
1645 Ga0307513_10065585 3300031456 Bacteria 3820
1646 Ga0307509_10000021 3300031507 Bacteria 250589
1647 Ga0307509_10000227 3300031507 Bacteria 90633
1648 Ga0307509_10003935 3300031507 Bacteria 21930
1649 Ga0307509_10006755 3300031507 Bacteria 15279
1650 Ga0307509_10033644 3300031507 Bacteria 5642
1651 Ga0307509_10081031 3300031507 Bacteria 3355
1652 Ga0307408_100000099 3300031548 Bacteria 95526
1653 Ga0307408_100000533 3300031548 Bacteria 32873
1654 Ga0307408_100002044 3300031548 Bacteria 14526
1655 Ga0307408_100002272 3300031548 Bacteria 13685
1656 Ga0307408_100004728 3300031548 Bacteria 9195
1657 Ga0307408_100004965 3300031548 Bacteria 8945
1658 Ga0307408_100005262 3300031548 Bacteria 8669
1659 Ga0307408_100005318 3300031548 Bacteria 8623
1660 Ga0307408_100006412 3300031548 Bacteria 7803
1661 Ga0307408_100006916 3300031548 Bacteria 7512
1662 Ga0307408_100010994 3300031548 Bacteria 5972
1663 Ga0307408_100016934 3300031548 Bacteria 4872
1664 Ga0265313_10000297 3300031595 Bacteria 53741
1665 Ga0265313_10000480 3300031595 Bacteria 41901
1666 Ga0265313_10000682 3300031595 Bacteria 34986
1667 Ga0265313_10002329 3300031595 Bacteria 16644
1668 Ga0265313_10005333 3300031595 Bacteria 9497
1669 Ga0265313_10006516 3300031595 Bacteria 8248
1670 Ga0265313_10007558 3300031595 Bacteria 7388
1671 Ga0307508_10000002 3300031616 Bacteria 407635
1672 Ga0307508_10006061 3300031616 Bacteria 11408
1673 Ga0307508_10009092 3300031616 Bacteria 9151
1674 Ga0307508_10012214 3300031616 Bacteria 7853
1675 Ga0307508_10039182 3300031616 Bacteria 4257
1676 Ga0307514_10000225 3300031649 Bacteria 151002
1677 Ga0307514_10004257 3300031649 Bacteria 13227
1678 Ga0307514_10008829 3300031649 Bacteria 8532
1679 Ga0307514_10024693 3300031649 Bacteria 4862
1680 Ga0307514_10047406 3300031649 Bacteria 3354
1681 Ga0316575_10000299 3300031665 Bacteria 13849
1682 Ga0316575_10005494 3300031665 Bacteria 4524
1683 Ga0316575_10007729 3300031665 Bacteria 3901
1684 Ga0316575_10012953 3300031665 Bacteria 3111
1685 Ga0316575_10018679 3300031665 Bacteria 2645
1686 Ga0316579_10000129 3300031691 Bacteria 20714
1687 Ga0316579_10001365 3300031691 Bacteria 8850
1688 Ga0316579_10005498 3300031691 Bacteria 5122
1689 Ga0316579_10006842 3300031691 Bacteria 4675
1690 Ga0316579_10012402 3300031691 Bacteria 3646
1691 Ga0316579_10014558 3300031691 Bacteria 3404
1692 Ga0265314_10000033 3300031711 Bacteria 254594
1693 Ga0265314_10000060 3300031711 Bacteria 161657
1694 Ga0265314_10000598 3300031711 Bacteria 45266
1695 Ga0265314_10000980 3300031711 Bacteria 33564
1696 Ga0265314_10001517 3300031711 Bacteria 25704
1697 Ga0265314_10003049 3300031711 Bacteria 16520
1698 Ga0265314_10004914 3300031711 Bacteria 12210
1699 Ga0265314_10006367 3300031711 Bacteria 10464
1700 Ga0265314_10034089 3300031711 Bacteria 3724
1701 Ga0265314_10040803 3300031711 Bacteria 3327
1702 Ga0265314_10044339 3300031711 Bacteria 3153
1703 Ga0265314_10052963 3300031711 Bacteria 2817
1704 Ga0265342_10000323 3300031712 Bacteria 53871
1705 Ga0265342_10000411 3300031712 Bacteria 47063
1706 Ga0265342_10000694 3300031712 Bacteria 35309
1707 Ga0265342_10000736 3300031712 Bacteria 33663
1708 Ga0265342_10001775 3300031712 Bacteria 19692
1709 Ga0265342_10002317 3300031712 Bacteria 16557
1710 Ga0265342_10004387 3300031712 Bacteria 11138
1711 Ga0265342_10007065 3300031712 Bacteria 8276
1712 Ga0265342_10009055 3300031712 Bacteria 7063
1713 Ga0265342_10011940 3300031712 Bacteria 5904
1714 Ga0265342_10020145 3300031712 Bacteria 4286
1715 Ga0265342_10027471 3300031712 Bacteria 3555
1716 Ga0265342_10036367 3300031712 Bacteria 3009
1717 Ga0265342_10037112 3300031712 Bacteria 2973
1718 Ga0316576_10000024 3300031727 Bacteria 43767
1719 Ga0316576_10000071 3300031727 Bacteria 34509
1720 Ga0316576_10000764 3300031727 Bacteria 16048
1721 Ga0316576_10005188 3300031727 Bacteria 7917
1722 Ga0316576_10007255 3300031727 Bacteria 6959
1723 Ga0316576_10008388 3300031727 Bacteria 6584
1724 Ga0316576_10008565 3300031727 Bacteria 6538
1725 Ga0316576_10012077 3300031727 Bacteria 5694
1726 Ga0316576_10014607 3300031727 Bacteria 5248
1727 Ga0316576_10016219 3300031727 Bacteria 5024
1728 Ga0316576_10018221 3300031727 Bacteria 4789
1729 Ga0316576_10019376 3300031727 Bacteria 4661
1730 Ga0316576_10022953 3300031727 Bacteria 4340
1731 Ga0316576_10030187 3300031727 Bacteria 3836
1732 Ga0316576_10039113 3300031727 Bacteria 3404
1733 Ga0316576_10054004 3300031727 Bacteria 2929
1734 Ga0316578_10000048 3300031728 Bacteria 24446
1735 Ga0316578_10001187 3300031728 Bacteria 10318
1736 Ga0316578_10001523 3300031728 Bacteria 9506
1737 Ga0316578_10003475 3300031728 Bacteria 7216
1738 Ga0316578_10003983 3300031728 Bacteria 6886
1739 Ga0316578_10006413 3300031728 Bacteria 5804
1740 Ga0316578_10007810 3300031728 Bacteria 5400
1741 Ga0316578_10008377 3300031728 Bacteria 5258
1742 Ga0316578_10011532 3300031728 Bacteria 4630
1743 Ga0316578_10017828 3300031728 Bacteria 3874
1744 Ga0316578_10023412 3300031728 Bacteria 3456
1745 Ga0307516_10002072 3300031730 Bacteria 27295
1746 Ga0307516_10006635 3300031730 Bacteria 13530
1747 Ga0307516_10006716 3300031730 Bacteria 13446
1748 Ga0307516_10006747 3300031730 Bacteria 13412
1749 Ga0307516_10009471 3300031730 Bacteria 10850
1750 Ga0307516_10011016 3300031730 Bacteria 9880
1751 Ga0307516_10021146 3300031730 Bacteria 6706
1752 Ga0307516_10036321 3300031730 Bacteria 4932
1753 Ga0307516_10051920 3300031730 Bacteria 4016
1754 Ga0307405_10019762 3300031731 Bacteria 3750
1755 Ga0307405_10028626 3300031731 Bacteria 3247
1756 Ga0316577_10000013 3300031733 Bacteria 38581
1757 Ga0316577_10000486 3300031733 Bacteria 15667
1758 Ga0316577_10000726 3300031733 Bacteria 14030
1759 Ga0316577_10000879 3300031733 Bacteria 13196
1760 Ga0316577_10001705 3300031733 Bacteria 10549
1761 Ga0316577_10003369 3300031733 Bacteria 8058
1762 Ga0316577_10004342 3300031733 Bacteria 7311
1763 Ga0316577_10005780 3300031733 Bacteria 6501
1764 Ga0316577_10015129 3300031733 Bacteria 4242
1765 Ga0316577_10017800 3300031733 Bacteria 3928
1766 Ga0316577_10018644 3300031733 Bacteria 3839
1767 Ga0316577_10019833 3300031733 Bacteria 3725
1768 Ga0316577_10028439 3300031733 Bacteria 3118
1769 Ga0316577_10035144 3300031733 Bacteria 2801
1770 Ga0316577_10052788 3300031733 Bacteria 2268
1771 Ga0307413_10001336 3300031824 Bacteria 9217
1772 Ga0307518_10000723 3300031838 Bacteria 24815
1773 Ga0307518_10000846 3300031838 Bacteria 22863
1774 Ga0307518_10003635 3300031838 Bacteria 11093
1775 Ga0307410_10000761 3300031852 Bacteria 13537
1776 Ga0307410_10006522 3300031852 Bacteria 6304
1777 Ga0307410_10027814 3300031852 Bacteria 3577
1778 Ga0307410_10032467 3300031852 Bacteria 3360
1779 Ga0326468_10000088 3300031889 Bacteria 7882
1780 Ga0307406_10000092 3300031901 Bacteria 50968
1781 Ga0307406_10000237 3300031901 Bacteria 33519
1782 Ga0307406_10016467 3300031901 Bacteria 4297
1783 Ga0307406_10019467 3300031901 Bacteria 3984
1784 Ga0307406_10019524 3300031901 Bacteria 3978
1785 Ga0307406_10025621 3300031901 Bacteria 3533
1786 Ga0307406_10048969 3300031901 Bacteria 2672
1787 Ga0307407_10011327 3300031903 Bacteria 4241
1788 Ga0307412_10000397 3300031911 Bacteria 26515
1789 Ga0307412_10001632 3300031911 Bacteria 12364
1790 Ga0307409_100000547 3300031995 Bacteria 16325
1791 Ga0307409_100002382 3300031995 Bacteria 9791
1792 Ga0307409_100009212 3300031995 Bacteria 6052
1793 Ga0307409_100024237 3300031995 Bacteria 4227
1794 Ga0307409_100037523 3300031995 Bacteria 3573
1795 Ga0307409_100048930 3300031995 Bacteria 3220
1796 Ga0307409_100076926 3300031995 Bacteria 2678
1797 Ga0307416_100014523 3300032002 Bacteria 5403
1798 Ga0307416_100036651 3300032002 Bacteria 3764
1799 Ga0307416_100040841 3300032002 Bacteria 3608
1800 Ga0307414_10000021 3300032004 Bacteria 213521
1801 Ga0307414_10010322 3300032004 Bacteria 5412
1802 Ga0307414_10013211 3300032004 Bacteria 4910
1803 Ga0307414_10026789 3300032004 Bacteria 3715
1804 Ga0307414_10040352 3300032004 Bacteria 3152
1805 Ga0307411_10000850 3300032005 Bacteria 11472
1806 Ga0307411_10005606 3300032005 Bacteria 6188
1807 Ga0307411_10012503 3300032005 Bacteria 4635
1808 Ga0307411_10060639 3300032005 Bacteria 2513
1809 Ga0307415_100026178 3300032126 Bacteria 3675
1810 Ga0307415_100041010 3300032126 Bacteria 3071
1811 Ga0307415_100053861 3300032126 Bacteria 2744
1812 Ga0307415_100055861 3300032126 Bacteria 2704
1813 Ga0307415_100057927 3300032126 Bacteria 2665
1814 Ga0316583_10000761 3300032133 Bacteria 10095
1815 Ga0316583_10003076 3300032133 Bacteria 5862
1816 Ga0316583_10003395 3300032133 Bacteria 5605
1817 Ga0316583_10009011 3300032133 Bacteria 3598
1818 Ga0316583_10009174 3300032133 Bacteria 3566
1819 Ga0316583_10010138 3300032133 Bacteria 3395
1820 Ga0316583_10019119 3300032133 Bacteria 2460
1821 Ga0316585_10001415 3300032137 Bacteria 6333
1822 Ga0316585_10001966 3300032137 Bacteria 5489
1823 Ga0316585_10006140 3300032137 Bacteria 3426
1824 Ga0316585_10011225 3300032137 Bacteria 2639
1825 Ga0316580_10000682 3300032139 Bacteria 8125
1826 Ga0316580_10005250 3300032139 Bacteria 3775
1827 Ga0316593_10004904 3300032168 Bacteria 3481
1828 Ga0316593_10006162 3300032168 Bacteria 3222
1829 Ga0316593_10007699 3300032168 Bacteria 2967
1830 Ga0316593_10008207 3300032168 Bacteria 2902
1831 Ga0316593_10010479 3300032168 Bacteria 2660
1832 Ga0316593_10012213 3300032168 Bacteria 2517
1833 Ga0316593_10013115 3300032168 Bacteria 2447
1834 Ga0316593_10014689 3300032168 Bacteria 2341
1835 Ga0316593_10014870 3300032168 Bacteria 2331
1836 Ga0316593_10014990 3300032168 Bacteria 2324
1837 Ga0316593_10015238 3300032168 Bacteria 2309
1838 Ga0316593_10015891 3300032168 Bacteria 2273
1839 Ga0307507_10000764 3300033179 Bacteria 70897
1840 Ga0307507_10027656 3300033179 Bacteria 6070
1841 Ga0307510_10000006 3300033180 Bacteria 566474
1842 Ga0307510_10001104 3300033180 Bacteria 28825
1843 Ga0307510_10001430 3300033180 Bacteria 26243
1844 Ga0307510_10010763 3300033180 Bacteria 10879
1845 Ga0316592_1006505 3300033524 Bacteria 2252
1846 Ga0316588_1006135 3300033528 Bacteria 2386
1847 Ga0316587_1002665 3300033529 Bacteria 2413
1848 Ga0316596_1002255 3300033541 Bacteria 4086
1849 Ga0316596_1004605 3300033541 Bacteria 3105
1850 Ga0316596_1005559 3300033541 Bacteria 2884
1851 Ga0316596_1006826 3300033541 Bacteria 2672
1852 Ga0316596_1008568 3300033541 Bacteria 2441
1853 Ga0316596_1009394 3300033541 Bacteria 2346
1854 Ga0316596_1010264 3300033541 Bacteria 2263
1855 Ga0373930_0000005 3300034816 Bacteria 25122
1856 Ga0373950_0000295 3300034818 Bacteria 6252
1857 Ga0373926_0002385 3300035083 Bacteria 5952
1858 Ga0373928_0002740 3300035084 Bacteria 3403
1859 Ga0373934_0000584 3300035086 Bacteria 12842
1860 Ga0373934_0001074 3300035086 Bacteria 9902
1861 Ga0373934_0002102 3300035086 Bacteria 7307
1862 Ga0373934_0011679 3300035086 Bacteria 3306
1863 Ga0373944_0001330 3300035089 Bacteria 6220
1864 Ga0373949_0000302 3300035090 Bacteria 17850
1865 Ga0373951_0000351 3300035091 Bacteria 13959
1866 Ga0373923_0001855 3300035111 Bacteria 6280
1867 Ga0373923_0008382 3300035111 Bacteria 3682
1868 Ga0373932_0001672 3300035112 Bacteria 6055
1869 Ga0373936_0001272 3300035113 Bacteria 9117
1870 Ga0373936_0001976 3300035113 Bacteria 7588
1871 Ga0373936_0007897 3300035113 Bacteria 3996
1872 Ga0373939_0000006 3300035114 Bacteria 78721
1873 Ga0373945_0011884 3300035116 Bacteria 2884
1874 Ga0373953_0000250 3300035117 Bacteria 14579
1875 Ga0373953_0009144 3300035117 Bacteria 3391
1876 Ga0373954_0000176 3300035118 Bacteria 23015
1877 Ga0373954_0002093 3300035118 Bacteria 8272
1878 Ga0373954_0007677 3300035118 Bacteria 4724
1879 Ga0373954_0024207 3300035118 Bacteria 2767
1880 Ga0373956_0000504 3300035119 Bacteria 15960
1881 Ga0373956_0000928 3300035119 Bacteria 12152
1882 Ga0373956_0001082 3300035119 Bacteria 11199
1883 Ga0373957_0000456 3300035120 Bacteria 10320
1884 Ga0373957_0011693 3300035120 Bacteria 2937
1885 Ga0373957_0012209 3300035120 Bacteria 2886
1886 Ga0373960_0003249 3300035121 Bacteria 3678
1887 Ga0373943_0000195 3300035170 Bacteria 24631
1888 Ga0373943_0002027 3300035170 Bacteria 9184
1889 Ga0373946_0000776 3300035171 Bacteria 10879
1890 Ga0373946_0001374 3300035171 Bacteria 8436
1891 Ga0373955_0000490 3300035172 Bacteria 16762
1892 Ga0373955_0019033 3300035172 Bacteria 3424
1893 Ga0373955_0020652 3300035172 Bacteria 3314
1894 Ga0373961_0000540 3300035241 Bacteria 14394
1895 Ga0373961_0000828 3300035241 Bacteria 10508
1896 Ga0373961_0005021 3300035241 Bacteria 3181
1897 Ga0373961_0006558 3300035241 Bacteria 2796
1898 Ga0373961_0007705 3300035241 Bacteria 2609
1899 Ga0373962_0005253 3300035242 Bacteria 3132
1900 Ga0373962_0005441 3300035242 Bacteria 3083
1901 Ga0316574_0000408 3300035398 Bacteria 16946
1902 Ga0316574_0001237 3300035398 Bacteria 11905
1903 Ga0316574_0002061 3300035398 Bacteria 9936
1904 Ga0316574_0002774 3300035398 Bacteria 8889
1905 Ga0316574_0003400 3300035398 Bacteria 8197
1906 Ga0316574_0004897 3300035398 Bacteria 7092
1907 Ga0316574_0007877 3300035398 Bacteria 5875
1908 Ga0316574_0008156 3300035398 Bacteria 5796
1909 Ga0316574_0008451 3300035398 Bacteria 5718
1910 Ga0316574_0009404 3300035398 Bacteria 5475
1911 Ga0316574_0011243 3300035398 Bacteria 5082
1912 Ga0316574_0012365 3300035398 Bacteria 4881
1913 Ga0316574_0013285 3300035398 Bacteria 4729
1914 Ga0316574_0023925 3300035398 Bacteria 3652
1915 Ga0316574_0025396 3300035398 Bacteria 3556
1916 Ga0373924_0000261 3300035410 Bacteria 16176
1917 Ga0373924_0004834 3300035410 Bacteria 4736
1918 Ga0373924_0025824 3300035410 Bacteria 2324
1919 Ga0373931_0000192 3300035691 Bacteria 26110
1920 Ga0373931_0007206 3300035691 Bacteria 5234
1921 Ga0373931_0032438 3300035691 Bacteria 2703
1922 Ga0373935_0000266 3300035692 Bacteria 25825
1923 Ga0373935_0021624 3300035692 Bacteria 3940
1924 Ga0373935_0050330 3300035692 Bacteria 2644
1925 Ga0373927_0002028 3300035695 Bacteria 14916
1926 Ga0373927_0002186 3300035695 Bacteria 14374
1927 Ga0373927_0003649 3300035695 Bacteria 10970
1928 Ga0373933_0000012 3300035724 Bacteria 108156
1929 Ga0373933_0001804 3300035724 Bacteria 12411
1930 Ga0373933_0010050 3300035724 Bacteria 5181
1931 Ga0373933_0023074 3300035724 Bacteria 3550
1932 Ga0373947_0000053 3300035725 Bacteria 57813
1933 Ga0373947_0000704 3300035725 Bacteria 19923
1934 Ga0373937_0000040 3300036401 Bacteria 108935
1935 Ga0373937_0000685 3300036401 Bacteria 29468
1936 Ga0373937_0001899 3300036401 Bacteria 17548
1937 Ga0373937_0004958 3300036401 Bacteria 11319
1938 Ga0373937_0007722 3300036401 Bacteria 9321
1939 Ga0373937_0009223 3300036401 Bacteria 8564
1940 Ga0373937_0010019 3300036401 Bacteria 8265
1941 Ga0373937_0013178 3300036401 Bacteria 7280
1942 Ga0373937_0014507 3300036401 Bacteria 6957
1943 Ga0373937_0020451 3300036401 Bacteria 5933
1944 Ga0373937_0033402 3300036401 Bacteria 4672
1945 Ga0373937_0050863 3300036401 Bacteria 3797
1946 Ga0373937_0078348 3300036401 Bacteria 3054
1947 Ga0373937_0091110 3300036401 Bacteria 2825
1948 Ga0316582_0000548 3300036647 Bacteria 14358
1949 Ga0316582_0008882 3300036647 Bacteria 5423
1950 Ga0316582_0009642 3300036647 Bacteria 5247
1951 Ga0316582_0011171 3300036647 Bacteria 4955
1952 Ga0316582_0014073 3300036647 Bacteria 4529
1953 Ga0316582_0018498 3300036647 Bacteria 4056
1954 Ga0316582_0019393 3300036647 Bacteria 3980
1955 Ga0316582_0025753 3300036647 Bacteria 3535
1956 Ga0316582_0043629 3300036647 Bacteria 2814
1957 Ga0316582_0055826 3300036647 Bacteria 2518
1958 Ga0316584_0000749 3300036712 Bacteria 18064
1959 Ga0316584_0000755 3300036712 Bacteria 18039
1960 Ga0316584_0000832 3300036712 Bacteria 17388
1961 Ga0316584_0005608 3300036712 Bacteria 8449
1962 Ga0316584_0007008 3300036712 Bacteria 7671
1963 Ga0316584_0008804 3300036712 Bacteria 6972
1964 Ga0316584_0009852 3300036712 Bacteria 6652
1965 Ga0316584_0010382 3300036712 Bacteria 6505
1966 Ga0316584_0013609 3300036712 Bacteria 5765
1967 Ga0316584_0015760 3300036712 Bacteria 5410
1968 Ga0316584_0017874 3300036712 Bacteria 5107
1969 Ga0316584_0020998 3300036712 Bacteria 4742
1970 Ga0316584_0022038 3300036712 Bacteria 4641
1971 Ga0316584_0022969 3300036712 Bacteria 4553
1972 Ga0316584_0023711 3300036712 Bacteria 4484
1973 Ga0316584_0032206 3300036712 Bacteria 3880
1974 Ga0316584_0034203 3300036712 Bacteria 3767
1975 Ga0316584_0047424 3300036712 Bacteria 3209
1976 Ga0316584_0088996 3300036712 Bacteria 2312
1977 Ga0373925_0000224 3300037068 Bacteria 60518
1978 Ga0373925_0003979 3300037068 Bacteria 11265
1979 Ga0373925_0005709 3300037068 Bacteria 9251
1980 Ga0373925_0014955 3300037068 Bacteria 5610
1981 Ga0373925_0059001 3300037068 Bacteria 2877
1982 Ga0395899_0000002 3300037312 Bacteria 1324310
1983 Ga0395899_0000038 3300037312 Bacteria 272627
1984 Ga0395899_0000153 3300037312 Bacteria 105214
1985 Ga0395899_0005101 3300037312 Bacteria 10222
1986 Ga0395899_0010062 3300037312 Bacteria 7251
1987 Ga0395899_0012721 3300037312 Bacteria 6446
1988 Ga0395899_0013361 3300037312 Bacteria 6281
1989 Ga0395900_0000030 3300037418 Bacteria 272630
1990 Ga0395900_0000166 3300037418 Bacteria 107636
1991 Ga0395900_0003714 3300037418 Bacteria 16404
1992 Ga0395900_0005356 3300037418 Bacteria 13446
1993 Ga0395900_0007219 3300037418 Bacteria 11511
1994 Ga0395900_0007813 3300037418 Bacteria 11024
1995 Ga0395900_0024217 3300037418 Bacteria 6215
1996 Ga0395900_0027495 3300037418 Bacteria 5828
1997 Ga0395900_0042705 3300037418 Bacteria 4671
1998 Ga0395900_0050525 3300037418 Bacteria 4283
1999 Ga0395900_0157747 3300037418 Bacteria 2317
2000 Ga0395898_0000238 3300037466 Bacteria 139658
2001 Ga0395898_0000637 3300037466 Bacteria 64022
2002 Ga0395898_0001413 3300037466 Bacteria 34194
2003 Ga0395898_0001576 3300037466 Bacteria 31191
2004 Ga0395898_0001776 3300037466 Bacteria 28103
2005 Ga0395898_0005657 3300037466 Bacteria 13478
2006 Ga0395898_0005929 3300037466 Bacteria 13128
2007 Ga0395898_0011263 3300037466 Bacteria 9303
2008 Ga0395898_0016701 3300037466 Bacteria 7501
2009 Ga0395898_0045149 3300037466 Bacteria 4332
2010 Ga0395898_0060525 3300037466 Bacteria 3680
2011 Ga0395898_0065611 3300037466 Bacteria 3519
2012 Ga0395898_0075738 3300037466 Bacteria 3250
2013 Ga0395898_0083014 3300037466 Bacteria 3088
2014 Ga0395898_0096553 3300037466 Bacteria 2839
2015 Ga0395905_0000279 3300037471 Bacteria 75846
2016 Ga0395905_0001877 3300037471 Bacteria 24203
2017 Ga0395905_0010974 3300037471 Bacteria 8768
2018 Ga0395905_0019865 3300037471 Bacteria 6367
2019 Ga0395905_0044136 3300037471 Bacteria 4183
2020 Ga0395905_0049792 3300037471 Bacteria 3927
2021 Ga0395905_0062487 3300037471 Bacteria 3484
2022 Ga0395905_0076152 3300037471 Bacteria 3145
2023 Ga0395905_0140554 3300037471 Bacteria 2271
2024 Ga0395905_0140914 3300037471 Bacteria 2268
2025 Ga0316581_0001090 3300037588 Bacteria 5877
2026 Ga0316581_0003198 3300037588 Bacteria 4049
2027 Ga0436364_0128024 3300037853 Bacteria 10198
2028 Ga0436364_0273345 3300037853 Bacteria 2794207
2029 Ga0436364_0748068 3300037853 Bacteria 528910
2030 Ga0436364_0948471 3300037853 Bacteria 3052
2031 Ga0436364_1025760 3300037853 Bacteria 46353
2032 Ga0436364_1087122 3300037853 Bacteria 9506
2033 Ga0436364_1407139 3300037853 Bacteria 7244
2034 Ga0395901_0004789 3300038443 Bacteria 13655
2035 Ga0395901_0005421 3300038443 Bacteria 12908
2036 Ga0395901_0017151 3300038443 Bacteria 7385
2037 Ga0395901_0021920 3300038443 Bacteria 6549
2038 Ga0395901_0025360 3300038443 Bacteria 6087
2039 Ga0395901_0030126 3300038443 Bacteria 5589
2040 Ga0395901_0039945 3300038443 Bacteria 4857
2041 Ga0395901_0073610 3300038443 Bacteria 3563
2042 Ga0395901_0097369 3300038443 Bacteria 3084
2043 Ga0237819_00233 3300038705 Bacteria 20367
2044 Ga0400484_17439 3300038725 Bacteria 12417
2045 Ga0400484_25352 3300038725 Bacteria 5309
2046 Ga0400484_28409 3300038725 Bacteria 3947
2047 Ga0400484_37293 3300038725 Bacteria 16850
2048 Ga0400490_00800 3300038726 Bacteria 3362
2049 Ga0400490_23936 3300038726 Bacteria 4686
2050 Ga0400490_28306 3300038726 Bacteria 18010
2051 Ga0400490_36327 3300038726 Bacteria 27463
2052 Ga0400490_41017 3300038726 Bacteria 14269
2053 Ga0400490_59028 3300038726 Bacteria 2803
2054 Ga0400491_20122 3300038727 Bacteria 7057
2055 Ga0400485_01479 3300038735 Bacteria 12220
2056 Ga0400485_15364 3300038735 Bacteria 6534
2057 Ga0400485_20818 3300038735 Bacteria 41766
2058 Ga0400485_21241 3300038735 Bacteria 9375
2059 Ga0400488_00498 3300038741 Bacteria 3676
2060 Ga0400488_28224 3300038741 Bacteria 11969
2061 Ga0400488_47383 3300038741 Bacteria 5766
2062 Ga0400488_53689 3300038741 Bacteria 3515
2063 Ga0400488_62492 3300038741 Bacteria 5891
2064 Ga0400486_04655 3300038742 Bacteria 8817
2065 Ga0400486_09341 3300038742 Bacteria 49508
2066 Ga0400486_09905 3300038742 Bacteria 12319
2067 Ga0400486_10140 3300038742 Bacteria 4010
2068 Ga0400486_11090 3300038742 Bacteria 19327
2069 Ga0400486_24636 3300038742 Bacteria 20439
2070 Ga0400483_032108 3300039062 Bacteria 16142
2071 Ga0400483_037918 3300039062 Bacteria 3201
2072 Ga0400483_040188 3300039062 Bacteria 19147
2073 Ga0400483_052816 3300039062 Bacteria 9683
2074 Ga0400483_067684 3300039062 Bacteria 5531
2075 Ga0400483_075863 3300039062 Bacteria 91295
2076 Ga0400483_113365 3300039062 Bacteria 44464
2077 Ga0400483_122822 3300039062 Bacteria 3257
2078 Ga0400483_145205 3300039062 Bacteria 8627
2079 Ga0400483_152793 3300039062 Bacteria 3931
2080 Ga0400483_155166 3300039062 Bacteria 4178
2081 Ga0400483_157229 3300039062 Bacteria 3139
2082 Ga0400483_192989 3300039062 Bacteria 16054
2083 Ga0400483_196159 3300039062 Bacteria 15835
2084 Ga0400483_213256 3300039062 Bacteria 4843
2085 Ga0400483_213432 3300039062 Bacteria 4955
2086 Ga0400483_252458 3300039062 Bacteria 53152
2087 Ga0400489_28607 3300039093 Bacteria 42332
2088 Ga0400489_46762 3300039093 Bacteria 6272
2089 Ga0400489_73587 3300039093 Bacteria 35735
2090 Ga0400489_80143 3300039093 Bacteria 65805
2091 Ga0400489_85534 3300039093 Bacteria 3818
2092 Ga0400487_14846 3300039110 Bacteria 15278
2093 Ga0400487_19245 3300039110 Bacteria 3204
2094 Ga0400487_27138 3300039110 Bacteria 3369
2095 Ga0400487_27990 3300039110 Bacteria 14760
2096 Ga0400487_41902 3300039110 Bacteria 9808
2097 Ga0400487_62511 3300039110 Bacteria 7256
2098 Ga0436365_0427175 3300039437 Bacteria 4337
2099 Ga0436365_0682371 3300039437 Bacteria 4376
2100 Ga0436365_0796873 3300039437 Bacteria 13546
2101 Ga0436365_0837091 3300039437 Bacteria 16775
2102 Ga0436365_1226289 3300039437 Bacteria 31121
2103 Ga0436365_1313651 3300039437 Bacteria 133292
2104 Ga0436360_1375098 3300039438 Bacteria 13243
2105 Ga0436361_0011167 3300039447 Bacteria 2619
2106 Ga0436361_0037688 3300039447 Bacteria 9246
2107 Ga0436361_0046151 3300039447 Bacteria 2657
2108 Ga0436361_0067750 3300039447 Bacteria 50874
2109 Ga0436361_0113272 3300039447 Bacteria 2190
2110 Ga0436361_0163583 3300039447 Bacteria 173204
2111 Ga0436361_0212642 3300039447 Bacteria 3209
2112 Ga0436361_0226365 3300039447 Bacteria 2761
2113 Ga0436361_0238581 3300039447 Bacteria 9503
2114 Ga0436361_0374490 3300039447 Bacteria 4877
2115 Ga0436361_0439945 3300039447 Bacteria 3988
2116 Ga0436361_0504916 3300039447 Bacteria 40492
2117 Ga0436361_0563398 3300039447 Bacteria 4719
2118 Ga0436361_0571302 3300039447 Bacteria 101663
2119 Ga0436361_0572581 3300039447 Bacteria 116104
2120 Ga0436361_0585306 3300039447 Bacteria 9577
2121 Ga0436361_0621878 3300039447 Bacteria 4158
2122 Ga0436361_1011630 3300039447 Bacteria 2334
2123 Ga0436361_1119934 3300039447 Bacteria 16342
2124 Ga0436363_0113379 3300039450 Bacteria 10864
2125 Ga0436363_0663159 3300039450 Bacteria 4685
2126 Ga0436362_0281836 3300039453 Bacteria 3155
2127 Ga0436362_0691671 3300039453 Bacteria 4104
2128 Ga0436362_1132636 3300039453 Bacteria 4115
2129 Ga0439436_0000007 3300041404 Bacteria 120812
2130 Ga0439438_001673 3300041405 Bacteria 9735
2131 Ga0439439_0002229 3300041406 Bacteria 4079
2132 Ga0439466_0000451 3300041411 Bacteria 15663
2133 Ga0439466_0002572 3300041411 Bacteria 7105
2134 Ga0451797_0504496 3300041453 Bacteria 3545
2135 Ga0451807_0543831 3300041486 Bacteria 2541
2136 Ga0451833_0316743 3300041491 Bacteria 8006
2137 Ga0451849_1124712 3300041505 Bacteria 3143
2138 Ga0451853_0508974 3300041512 Bacteria 37152
2139 Ga0451853_0592879 3300041512 Bacteria 5194
2140 Ga0439433_0001073 3300041999 Bacteria 5547
2141 Ga0439448_0001885 3300042005 Bacteria 5577
2142 Ga0439448_0011958 3300042005 Bacteria 2592
2143 Ga0439432_001665 3300042006 Bacteria 8324
2144 Ga0439449_0000048 3300042007 Bacteria 36681
2145 Ga0439449_0000368 3300042007 Bacteria 16559
2146 Ga0439452_000081 3300042010 Bacteria 82231
2147 Ga0439463_009869 3300042016 Bacteria 2345
2148 Ga0450911_000488 3300042115 Bacteria 12619
2149 Ga0450894_000203 3300042131 Bacteria 10675
2150 Ga0450898_000240 3300042134 Bacteria 5995
2151 Ga0450903_000737 3300042138 Bacteria 6470
2152 Ga0450905_000574 3300042142 Bacteria 4537
2153 Ga0450906_000446 3300042145 Bacteria 8593
2154 Ga0450908_000082 3300042184 Bacteria 19349
2155 Ga0450908_004764 3300042184 Bacteria 2611
2156 Ga0450909_000554 3300042185 Bacteria 4935
2157 Ga0439459_0001107 3300042438 Bacteria 3879
2158 Ga0450918_002789 3300042531 Bacteria 3277
2159 Ga0451577_0000058 3300042876 Bacteria 272673
2160 Ga0451577_0000088 3300042876 Bacteria 206788
2161 Ga0451577_0001017 3300042876 Bacteria 40741
2162 Ga0451577_0001428 3300042876 Bacteria 31881
2163 Ga0451577_0001853 3300042876 Bacteria 26943
2164 Ga0451577_0002260 3300042876 Bacteria 23357
2165 Ga0451577_0002558 3300042876 Bacteria 21470
2166 Ga0451577_0003244 3300042876 Bacteria 18290
2167 Ga0451577_0003348 3300042876 Bacteria 17948
2168 Ga0451577_0006299 3300042876 Bacteria 11881
2169 Ga0451577_0006640 3300042876 Bacteria 11488
2170 Ga0451577_0006814 3300042876 Bacteria 11321
2171 Ga0451577_0007375 3300042876 Bacteria 10797
2172 Ga0451577_0007445 3300042876 Bacteria 10753
2173 Ga0451577_0011435 3300042876 Bacteria 8397
2174 Ga0451577_0011909 3300042876 Bacteria 8200
2175 Ga0451577_0012031 3300042876 Bacteria 8143
2176 Ga0451577_0015174 3300042876 Bacteria 7168
2177 Ga0451577_0015803 3300042876 Bacteria 7004
2178 Ga0451577_0041117 3300042876 Bacteria 4150
2179 Ga0451577_0055139 3300042876 Bacteria 3547
2180 Ga0451577_0056319 3300042876 Bacteria 3506
2181 Ga0466969_0002066 3300044656 Bacteria 10721
2182 Ga0466969_0002259 3300044656 Bacteria 10293
2183 Ga0466969_0003221 3300044656 Bacteria 8684
2184 Ga0466969_0015334 3300044656 Bacteria 4017
2185 Ga0466969_0029729 3300044656 Bacteria 2788
2186 Ga0466972_0002696 3300044658 Bacteria 8790
2187 Ga0466972_0004557 3300044658 Bacteria 6942
2188 Ga0466972_0006500 3300044658 Bacteria 5871
2189 Ga0466972_0006992 3300044658 Bacteria 5659
2190 Ga0453683_0000202 3300044673 Bacteria 81085
2191 Ga0453683_0002516 3300044673 Bacteria 14143
2192 Ga0453683_0002933 3300044673 Bacteria 12859
2193 Ga0453683_0003002 3300044673 Bacteria 12632
2194 Ga0453683_0006351 3300044673 Bacteria 8117
2195 Ga0453683_0010946 3300044673 Bacteria 5997
2196 Ga0453683_0014896 3300044673 Bacteria 5048
2197 Ga0453683_0028218 3300044673 Bacteria 3554
2198 Ga0453683_0053520 3300044673 Bacteria 2526
2199 Ga0466965_0000672 3300044683 Bacteria 12575
2200 Ga0466965_0001462 3300044683 Bacteria 9548
2201 Ga0466965_0002745 3300044683 Bacteria 7550
2202 Ga0466965_0012690 3300044683 Bacteria 3968
2203 Ga0466965_0040028 3300044683 Bacteria 2305
2204 Ga0466966_0001303 3300044684 Bacteria 15980
2205 Ga0466966_0002484 3300044684 Bacteria 12074
2206 Ga0466966_0005917 3300044684 Bacteria 8072
2207 Ga0466966_0007719 3300044684 Bacteria 7124
2208 Ga0466966_0008870 3300044684 Bacteria 6661
2209 Ga0466966_0026812 3300044684 Bacteria 3761
2210 Ga0466966_0034131 3300044684 Bacteria 3292
2211 Ga0466966_0045359 3300044684 Bacteria 2810
2212 Ga0466966_0053314 3300044684 Bacteria 2566
2213 Ga0466961_0000032 3300044693 Bacteria 85497
2214 Ga0466961_0000114 3300044693 Bacteria 53585
2215 Ga0466961_0002711 3300044693 Bacteria 11006
2216 Ga0466961_0009884 3300044693 Bacteria 6078
2217 Ga0466961_0011538 3300044693 Bacteria 5651
2218 Ga0466961_0013721 3300044693 Bacteria 5192
2219 Ga0466961_0048499 3300044693 Bacteria 2714
2220 Ga0466963_0000083 3300044694 Bacteria 32696
2221 Ga0466963_0000698 3300044694 Bacteria 16362
2222 Ga0466963_0000833 3300044694 Bacteria 15462
2223 Ga0466963_0002989 3300044694 Bacteria 9560
2224 Ga0466963_0004900 3300044694 Bacteria 7807
2225 Ga0466963_0023735 3300044694 Bacteria 3898
2226 Ga0466963_0023943 3300044694 Bacteria 3883
2227 Ga0466963_0025689 3300044694 Bacteria 3759
2228 Ga0466963_0030502 3300044694 Bacteria 3480
2229 Ga0466963_0047961 3300044694 Bacteria 2820
2230 Ga0466963_0089840 3300044694 Bacteria 2090
2231 Ga0466964_0012399 3300044706 Bacteria 3225
2232 Ga0453684_0000023 3300044712 Bacteria 857153
2233 Ga0453684_0000035 3300044712 Bacteria 725956
2234 Ga0453684_0000117 3300044712 Bacteria 348119
2235 Ga0453684_0000122 3300044712 Bacteria 340529
2236 Ga0453684_0000123 3300044712 Bacteria 339304
2237 Ga0453684_0000309 3300044712 Bacteria 207063
2238 Ga0453684_0001316 3300044712 Bacteria 73394
2239 Ga0453684_0001369 3300044712 Bacteria 70779
2240 Ga0453684_0001573 3300044712 Bacteria 63310
2241 Ga0453684_0001689 3300044712 Bacteria 59652
2242 Ga0453684_0002899 3300044712 Bacteria 40225
2243 Ga0453684_0003095 3300044712 Bacteria 38334
2244 Ga0453684_0003174 3300044712 Bacteria 37753
2245 Ga0453684_0003781 3300044712 Bacteria 33417
2246 Ga0453684_0004095 3300044712 Bacteria 31626
2247 Ga0453684_0004998 3300044712 Bacteria 26950
2248 Ga0453684_0005133 3300044712 Bacteria 26345
2249 Ga0453684_0005764 3300044712 Bacteria 24186
2250 Ga0453684_0009058 3300044712 Bacteria 17565
2251 Ga0453684_0010772 3300044712 Bacteria 15518
2252 Ga0453684_0011197 3300044712 Bacteria 15100
2253 Ga0453684_0013863 3300044712 Bacteria 13006
2254 Ga0453684_0014164 3300044712 Bacteria 12809
2255 Ga0453684_0018333 3300044712 Bacteria 10754
2256 Ga0453684_0018763 3300044712 Bacteria 10588
2257 Ga0453684_0026704 3300044712 Bacteria 8322
2258 Ga0453684_0027549 3300044712 Bacteria 8144
2259 Ga0453684_0027559 3300044712 Bacteria 8142
2260 Ga0453684_0038203 3300044712 Bacteria 6568
2261 Ga0453684_0039873 3300044712 Bacteria 6389
2262 Ga0453684_0041187 3300044712 Bacteria 6254
2263 Ga0453684_0056412 3300044712 Bacteria 5095
2264 Ga0453684_0060551 3300044712 Bacteria 4867
2265 Ga0453684_0063084 3300044712 Bacteria 4743
2266 Ga0453684_0068279 3300044712 Bacteria 4515
2267 Ga0453684_0083148 3300044712 Bacteria 3985
2268 Ga0453684_0206038 3300044712 Bacteria 2289
2269 Ga0466971_0000832 3300044719 Bacteria 12518
2270 Ga0466971_0001539 3300044719 Bacteria 9707
2271 Ga0466968_0001217 3300044735 Bacteria 9111
2272 Ga0466970_0000056 3300044765 Bacteria 43205
2273 Ga0466970_0000190 3300044765 Bacteria 29698
2274 Ga0466970_0014824 3300044765 Bacteria 4005
2275 Ga0466970_0031555 3300044765 Bacteria 2799
2276 Ga0466957_0000029 3300044842 Bacteria 52517
2277 Ga0466957_0000407 3300044842 Bacteria 21025
2278 Ga0466957_0007421 3300044842 Bacteria 6193
2279 Ga0466957_0010563 3300044842 Bacteria 5306
2280 Ga0466957_0021238 3300044842 Bacteria 3824
2281 Ga0466957_0028457 3300044842 Bacteria 3327
2282 Ga0466957_0039297 3300044842 Bacteria 2854
2283 Ga0466960_0000453 3300044901 Bacteria 14015
2284 Ga0466960_0004303 3300044901 Bacteria 5550
2285 Ga0466960_0006063 3300044901 Bacteria 4832
2286 Ga0466960_0008068 3300044901 Bacteria 4300
2287 Ga0466960_0013847 3300044901 Bacteria 3436
2288 Ga0466959_0005553 3300045049 Bacteria 8655
2289 Ga0466959_0011309 3300045049 Bacteria 6408
2290 Ga0466959_0037859 3300045049 Bacteria 3565
2291 Ga0466959_0038615 3300045049 Bacteria 3528
2292 Ga0466959_0048245 3300045049 Bacteria 3129
2293 Ga0466959_0049819 3300045049 Bacteria 3076
2294 Ga0466959_0052798 3300045049 Bacteria 2975
2295 Ga0451576_0000022 3300045051 Bacteria 495037
2296 Ga0451576_0000231 3300045051 Bacteria 136040
2297 Ga0451576_0000364 3300045051 Bacteria 108727
2298 Ga0451576_0000464 3300045051 Bacteria 91776
2299 Ga0451576_0000775 3300045051 Bacteria 62938
2300 Ga0451576_0001259 3300045051 Bacteria 44476
2301 Ga0451576_0004497 3300045051 Bacteria 18051
2302 Ga0451576_0005882 3300045051 Bacteria 15225
2303 Ga0451576_0029228 3300045051 Bacteria 5898
2304 Ga0451576_0043379 3300045051 Bacteria 4746
2305 Ga0451576_0084655 3300045051 Bacteria 3299
2306 Ga0466958_0000232 3300045836 Bacteria 21249
2307 Ga0466958_0000321 3300045836 Bacteria 19095
2308 Ga0466958_0002855 3300045836 Bacteria 8794
2309 Ga0466958_0010024 3300045836 Bacteria 5294
2310 Ga0466958_0011084 3300045836 Bacteria 5069
2311 Ga0466958_0012062 3300045836 Bacteria 4884
2312 Ga0466958_0014677 3300045836 Bacteria 4473
2313 Ga0466958_0046195 3300045836 Bacteria 2628
2314 Ga0466958_0052628 3300045836 Bacteria 2468
2315 Ga0466967_0000677 3300045976 Bacteria 17270
2316 Ga0466967_0004268 3300045976 Bacteria 9604
2317 Ga0466967_0006969 3300045976 Bacteria 8087
2318 Ga0466967_0007899 3300045976 Bacteria 7734
2319 Ga0466967_0011243 3300045976 Bacteria 6765
2320 Ga0466967_0011765 3300045976 Bacteria 6653
2321 Ga0466967_0013154 3300045976 Bacteria 6378
2322 Ga0466967_0022096 3300045976 Bacteria 5183
2323 Ga0466967_0024180 3300045976 Bacteria 4991
2324 Ga0466967_0026234 3300045976 Bacteria 4822
2325 Ga0466967_0031166 3300045976 Bacteria 4485
2326 Ga0466967_0047489 3300045976 Bacteria 3743
2327 Ga0466967_0052125 3300045976 Bacteria 3589
2328 Ga0466967_0065863 3300045976 Bacteria 3226
2329 Ga0466967_0069521 3300045976 Bacteria 3147
2330 Ga0466967_0069827 3300045976 Bacteria 3141
2331 Ga0495617_000020 3300046452 Bacteria 230257
2332 Ga0495617_000045 3300046452 Bacteria 116918
2333 Ga0495627_000001 3300046453 Bacteria 1104709
2334 Ga0495627_000101 3300046453 Bacteria 105414
2335 Ga0495627_001944 3300046453 Bacteria 10740
2336 Ga0495627_003778 3300046453 Bacteria 6534
2337 Ga0495592_0000106 3300046454 Bacteria 74359
2338 Ga0495592_0010969 3300046454 Bacteria 6837
2339 Ga0495592_0023643 3300046454 Bacteria 4674
2340 Ga0495592_0027876 3300046454 Bacteria 4278
2341 Ga0495603_0000505 3300046455 Bacteria 21670
2342 Ga0495603_0003164 3300046455 Bacteria 9792
2343 Ga0495590_0007486 3300046457 Bacteria 4210
2344 Ga0495591_000032 3300046458 Bacteria 176337
2345 Ga0495591_000082 3300046458 Bacteria 107579
2346 Ga0495591_000120 3300046458 Bacteria 86214
2347 Ga0495591_008617 3300046458 Bacteria 4157
2348 Ga0495591_011910 3300046458 Bacteria 3265
2349 Ga0495629_0000168 3300046459 Bacteria 57984
2350 Ga0495629_0003590 3300046459 Bacteria 11715
2351 Ga0495629_0005629 3300046459 Bacteria 9360
2352 Ga0495629_0076458 3300046459 Bacteria 2338
2353 Ga0495638_0000449 3300046460 Bacteria 49303
2354 Ga0495638_0001787 3300046460 Bacteria 18739
2355 Ga0495638_0012733 3300046460 Bacteria 5751
2356 Ga0495638_0015895 3300046460 Bacteria 5043
2357 Ga0495638_0052042 3300046460 Bacteria 2552
2358 Ga0495641_0001114 3300046461 Bacteria 23115
2359 Ga0495651_0000040 3300046462 Bacteria 94890
2360 Ga0495651_0000281 3300046462 Bacteria 39620
2361 Ga0495651_0006326 3300046462 Bacteria 9057
2362 Ga0495651_0011493 3300046462 Bacteria 6799
2363 Ga0495651_0032621 3300046462 Bacteria 4061
2364 Ga0495651_0037277 3300046462 Bacteria 3785
2365 Ga0495651_0052301 3300046462 Bacteria 3146
2366 Ga0495653_0000051 3300046463 Bacteria 106012
2367 Ga0495653_0000082 3300046463 Bacteria 80285
2368 Ga0495653_0001238 3300046463 Bacteria 19776
2369 Ga0495653_0009937 3300046463 Bacteria 7784
2370 Ga0495653_0012929 3300046463 Bacteria 6810
2371 Ga0495653_0022514 3300046463 Bacteria 5098
2372 Ga0495653_0043857 3300046463 Bacteria 3474
2373 Ga0495653_0048483 3300046463 Bacteria 3278
2374 Ga0495653_0069040 3300046463 Bacteria 2649
2375 Ga0495650_0000015 3300046471 Bacteria 557595
2376 Ga0495650_0000069 3300046471 Bacteria 261124
2377 Ga0495650_0000108 3300046471 Bacteria 200369
2378 Ga0495650_0000462 3300046471 Bacteria 63149
2379 Ga0495650_0005553 3300046471 Bacteria 8141
2380 Ga0495650_0013749 3300046471 Bacteria 4258
2381 Ga0495580_0002009 3300046472 Bacteria 17901
2382 Ga0495580_0002656 3300046472 Bacteria 15529
2383 Ga0495580_0007903 3300046472 Bacteria 8507
2384 Ga0495580_0010389 3300046472 Bacteria 7256
2385 Ga0495580_0051366 3300046472 Bacteria 2915
2386 Ga0495582_0003038 3300046473 Bacteria 9403
2387 Ga0495582_0040044 3300046473 Bacteria 2580
2388 Ga0495605_0000029 3300046474 Bacteria 215329
2389 Ga0495605_0000147 3300046474 Bacteria 90988
2390 Ga0495605_0002910 3300046474 Bacteria 10387
2391 Ga0495605_0004096 3300046474 Bacteria 8602
2392 Ga0495605_0005387 3300046474 Bacteria 7457
2393 Ga0495605_0008491 3300046474 Bacteria 5806
2394 Ga0495605_0009688 3300046474 Bacteria 5414
2395 Ga0495605_0017022 3300046474 Bacteria 3925
2396 Ga0495605_0019718 3300046474 Bacteria 3596
2397 Ga0495605_0022992 3300046474 Bacteria 3284
2398 Ga0495639_0000001 3300046475 Bacteria 204442
2399 Ga0495662_0000636 3300046476 Bacteria 16377
2400 Ga0495662_0008955 3300046476 Bacteria 4916
2401 Ga0495664_0001541 3300046477 Bacteria 12206
2402 Ga0495664_0004460 3300046477 Bacteria 7663
2403 Ga0495664_0011970 3300046477 Bacteria 4901
2404 Ga0495664_0021437 3300046477 Bacteria 3732
2405 Ga0495664_0059566 3300046477 Bacteria 2273
2406 Ga0495584_0000033 3300046491 Bacteria 99309
2407 Ga0495584_0000052 3300046491 Bacteria 87015
2408 Ga0495584_0000270 3300046491 Bacteria 36812
2409 Ga0495584_0032132 3300046491 Bacteria 2657
2410 Ga0495585_0000003 3300046492 Bacteria 406344
2411 Ga0495585_0000016 3300046492 Bacteria 175433
2412 Ga0495585_0000049 3300046492 Bacteria 119546
2413 Ga0495585_0000075 3300046492 Bacteria 102563
2414 Ga0495585_0000424 3300046492 Bacteria 40738
2415 Ga0495585_0003440 3300046492 Bacteria 10693
2416 Ga0495585_0003811 3300046492 Bacteria 10041
2417 Ga0495585_0013500 3300046492 Bacteria 4777
2418 Ga0495585_0020891 3300046492 Bacteria 3761
2419 Ga0495594_0041239 3300046499 Bacteria 2528
2420 Ga0495596_0000019 3300046500 Bacteria 114118
2421 Ga0495596_0000371 3300046500 Bacteria 28783
2422 Ga0495596_0000640 3300046500 Bacteria 21994
2423 Ga0495607_0000019 3300046501 Bacteria 167319
2424 Ga0495607_0002702 3300046501 Bacteria 14149
2425 Ga0495607_0003555 3300046501 Bacteria 11870
2426 Ga0495607_0004167 3300046501 Bacteria 10749
2427 Ga0495607_0006134 3300046501 Bacteria 8504
2428 Ga0495607_0006425 3300046501 Bacteria 8279
2429 Ga0495607_0014459 3300046501 Bacteria 5134
2430 Ga0495583_0000057 3300046506 Bacteria 200688
2431 Ga0495583_0000169 3300046506 Bacteria 111114
2432 Ga0495583_0000173 3300046506 Bacteria 109405
2433 Ga0495583_0000625 3300046506 Bacteria 47513
2434 Ga0495583_0000932 3300046506 Bacteria 34250
2435 Ga0495583_0004929 3300046506 Bacteria 9277
2436 Ga0495583_0005767 3300046506 Bacteria 8279
2437 Ga0495583_0014158 3300046506 Bacteria 4414
2438 Ga0495583_0015459 3300046506 Bacteria 4149
2439 Ga0495583_0015660 3300046506 Bacteria 4111
2440 Ga0495606_0000161 3300046507 Bacteria 117607
2441 Ga0495606_0000555 3300046507 Bacteria 59635
2442 Ga0495606_0000600 3300046507 Bacteria 57013
2443 Ga0495606_0000676 3300046507 Bacteria 53366
2444 Ga0495606_0000709 3300046507 Bacteria 51609
2445 Ga0495606_0000806 3300046507 Bacteria 47839
2446 Ga0495606_0001735 3300046507 Bacteria 28008
2447 Ga0495606_0004479 3300046507 Bacteria 13928
2448 Ga0495606_0006881 3300046507 Bacteria 10363
2449 Ga0495606_0007103 3300046507 Bacteria 10124
2450 Ga0495606_0007373 3300046507 Bacteria 9870
2451 Ga0495606_0008931 3300046507 Bacteria 8581
2452 Ga0495606_0009833 3300046507 Bacteria 8025
2453 Ga0495606_0012781 3300046507 Bacteria 6689
2454 Ga0495606_0014135 3300046507 Bacteria 6249
2455 Ga0495606_0021425 3300046507 Bacteria 4734
2456 Ga0495606_0033496 3300046507 Bacteria 3542
2457 Ga0495608_0000044 3300046511 Bacteria 108171
2458 Ga0495608_0001258 3300046511 Bacteria 18015
2459 Ga0495608_0016431 3300046511 Bacteria 5122
2460 Ga0495608_0019750 3300046511 Bacteria 4633
2461 Ga0495608_0035148 3300046511 Bacteria 3381
2462 Ga0495610_0000014 3300046512 Bacteria 444708
2463 Ga0495610_0000128 3300046512 Bacteria 83166
2464 Ga0495610_0000133 3300046512 Bacteria 82356
2465 Ga0495610_0000927 3300046512 Bacteria 27234
2466 Ga0495610_0005388 3300046512 Bacteria 9118
2467 Ga0495616_0000054 3300046513 Bacteria 104326
2468 Ga0495616_0000260 3300046513 Bacteria 42862
2469 Ga0495616_0000684 3300046513 Bacteria 25114
2470 Ga0495616_0000734 3300046513 Bacteria 24092
2471 Ga0495616_0001757 3300046513 Bacteria 14739
2472 Ga0495616_0004524 3300046513 Bacteria 8754
2473 Ga0495616_0004535 3300046513 Bacteria 8744
2474 Ga0495616_0007477 3300046513 Bacteria 6539
2475 Ga0495616_0009188 3300046513 Bacteria 5799
2476 Ga0495618_0032188 3300046514 Bacteria 3284
2477 Ga0495618_0065507 3300046514 Bacteria 2309
2478 Ga0495620_0000059 3300046515 Bacteria 95876
2479 Ga0495620_0000127 3300046515 Bacteria 62010
2480 Ga0495620_0001048 3300046515 Bacteria 16948
2481 Ga0495620_0005030 3300046515 Bacteria 7408
2482 Ga0495620_0016425 3300046515 Bacteria 3714
2483 Ga0495628_0000439 3300046516 Bacteria 37888
2484 Ga0495628_0000450 3300046516 Bacteria 37523
2485 Ga0495628_0017521 3300046516 Bacteria 5960
2486 Ga0495628_0062079 3300046516 Bacteria 2929
2487 Ga0495631_0000013 3300046518 Bacteria 109794
2488 Ga0495631_0020966 3300046518 Bacteria 3046
2489 Ga0495631_0023566 3300046518 Bacteria 2852
2490 Ga0495632_0000579 3300046519 Bacteria 33995
2491 Ga0495632_0000907 3300046519 Bacteria 25969
2492 Ga0495632_0002535 3300046519 Bacteria 13843
2493 Ga0495632_0011838 3300046519 Bacteria 5073
2494 Ga0495632_0014668 3300046519 Bacteria 4424
2495 Ga0495632_0018525 3300046519 Bacteria 3821
2496 Ga0495637_0000006 3300046520 Bacteria 435763
2497 Ga0495637_0006007 3300046520 Bacteria 6135
2498 Ga0495637_0021474 3300046520 Bacteria 2959
2499 Ga0495643_0000087 3300046522 Bacteria 156505
2500 Ga0495643_0000396 3300046522 Bacteria 57359
2501 Ga0495643_0000406 3300046522 Bacteria 56381
2502 Ga0495643_0000882 3300046522 Bacteria 31936
2503 Ga0495643_0001250 3300046522 Bacteria 24372
2504 Ga0495643_0003954 3300046522 Bacteria 10605
2505 Ga0495643_0005166 3300046522 Bacteria 8913
2506 Ga0495643_0010932 3300046522 Bacteria 5556
2507 Ga0495644_0003040 3300046523 Bacteria 6638
2508 Ga0495644_0005363 3300046523 Bacteria 5007
2509 Ga0495644_0008014 3300046523 Bacteria 4062
2510 Ga0495648_0000011 3300046524 Bacteria 299518
2511 Ga0495648_0000104 3300046524 Bacteria 105792
2512 Ga0495648_0000392 3300046524 Bacteria 47998
2513 Ga0495648_0000734 3300046524 Bacteria 35054
2514 Ga0495648_0001013 3300046524 Bacteria 28776
2515 Ga0495648_0001083 3300046524 Bacteria 27678
2516 Ga0495648_0002586 3300046524 Bacteria 16576
2517 Ga0495648_0003040 3300046524 Bacteria 15019
2518 Ga0495648_0006050 3300046524 Bacteria 9928
2519 Ga0495648_0006649 3300046524 Bacteria 9362
2520 Ga0495648_0011427 3300046524 Bacteria 6688
2521 Ga0495648_0019209 3300046524 Bacteria 4814
2522 Ga0495648_0030330 3300046524 Bacteria 3577
2523 Ga0495648_0030477 3300046524 Bacteria 3566
2524 Ga0495666_0009547 3300046526 Bacteria 4848
2525 Ga0495666_0012871 3300046526 Bacteria 4170
2526 Ga0495642_0000305 3300046528 Bacteria 27376
2527 Ga0495642_0002022 3300046528 Bacteria 8456
2528 Ga0495642_0011985 3300046528 Bacteria 3340
2529 Ga0495652_0001063 3300046529 Bacteria 31154
2530 Ga0495652_0001238 3300046529 Bacteria 28551
2531 Ga0495652_0001868 3300046529 Bacteria 22396
2532 Ga0495652_0013586 3300046529 Bacteria 7328
2533 Ga0495652_0018196 3300046529 Bacteria 6270
2534 Ga0495652_0037557 3300046529 Bacteria 4201
2535 Ga0495652_0076051 3300046529 Bacteria 2786
2536 Ga0495654_0000104 3300046530 Bacteria 95266
2537 Ga0495654_0001192 3300046530 Bacteria 18488
2538 Ga0495654_0003890 3300046530 Bacteria 9027
2539 Ga0495654_0004007 3300046530 Bacteria 8855
2540 Ga0495654_0012609 3300046530 Bacteria 4538
2541 Ga0495665_0012811 3300046531 Bacteria 4537
2542 Ga0495665_0038416 3300046531 Bacteria 2552
2543 Ga0495640_0015569 3300046533 Bacteria 5719
2544 Ga0495640_0026789 3300046533 Bacteria 4160
2545 Ga0495640_0029076 3300046533 Bacteria 3972
2546 Ga0495640_0032788 3300046533 Bacteria 3696
2547 Ga0495640_0042822 3300046533 Bacteria 3156
2548 Ga0495586_0011917 3300046535 Bacteria 4618
2549 Ga0495587_0000046 3300046536 Bacteria 108171
2550 Ga0495587_0000591 3300046536 Bacteria 24874
2551 Ga0495587_0007916 3300046536 Bacteria 6864
2552 Ga0495587_0009821 3300046536 Bacteria 6114
2553 Ga0495587_0029886 3300046536 Bacteria 3307
2554 Ga0495609_0000345 3300046538 Bacteria 40772
2555 Ga0495609_0000879 3300046538 Bacteria 21988
2556 Ga0495609_0001219 3300046538 Bacteria 17718
2557 Ga0495609_0001815 3300046538 Bacteria 13707
2558 Ga0495609_0027959 3300046538 Bacteria 2575
2559 Ga0495597_0000965 3300046542 Bacteria 22210
2560 Ga0495597_0000986 3300046542 Bacteria 21941
2561 Ga0495645_0038587 3300046543 Bacteria 3483
2562 Ga0495645_0073304 3300046543 Bacteria 2467
2563 Ga0495622_0000034 3300046557 Bacteria 123671
2564 Ga0495622_0000047 3300046557 Bacteria 109638
2565 Ga0495622_0000181 3300046557 Bacteria 51031
2566 Ga0495622_0009809 3300046557 Bacteria 4428
2567 Ga0495633_0000304 3300046558 Bacteria 55996
2568 Ga0495633_0000597 3300046558 Bacteria 34839
2569 Ga0495633_0001240 3300046558 Bacteria 20410
2570 Ga0495633_0002356 3300046558 Bacteria 13393
2571 Ga0495633_0008225 3300046558 Bacteria 5903
2572 Ga0495667_0000518 3300046559 Bacteria 24595
2573 Ga0495667_0001587 3300046559 Bacteria 15088
2574 Ga0495667_0016517 3300046559 Bacteria 4987
2575 Ga0495667_0035156 3300046559 Bacteria 3349
2576 Ga0495667_0039111 3300046559 Bacteria 3156
2577 Ga0495656_0000520 3300046615 Bacteria 12556
2578 Ga0495656_0013401 3300046615 Bacteria 3050
2579 Ga0495656_0015951 3300046615 Bacteria 2845
2580 Ga0495668_0000579 3300046616 Bacteria 44604
2581 Ga0495668_0001185 3300046616 Bacteria 26483
2582 Ga0495668_0001336 3300046616 Bacteria 24234
2583 Ga0495668_0001366 3300046616 Bacteria 23914
2584 Ga0495668_0002315 3300046616 Bacteria 15930
2585 Ga0495668_0006131 3300046616 Bacteria 7959
2586 Ga0495668_0008541 3300046616 Bacteria 6377
2587 Ga0495668_0010871 3300046616 Bacteria 5481
2588 Ga0495668_0011480 3300046616 Bacteria 5302
2589 Ga0495668_0016706 3300046616 Bacteria 4267
2590 Ga0495668_0035526 3300046616 Bacteria 2793
2591 Ga0495668_0040493 3300046616 Bacteria 2598
2592 Ga0495634_0003764 3300046642 Bacteria 12065
2593 Ga0495634_0004939 3300046642 Bacteria 10309
2594 Ga0495634_0011887 3300046642 Bacteria 6324
2595 Ga0495634_0030669 3300046642 Bacteria 3711
2596 Ga0495611_0000024 3300046648 Bacteria 118898
2597 Ga0495611_0000613 3300046648 Bacteria 20576
2598 Ga0495611_0013752 3300046648 Bacteria 3449
2599 Ga0495625_0000103 3300046660 Bacteria 136109
2600 Ga0495625_0000615 3300046660 Bacteria 51688
2601 Ga0495625_0002403 3300046660 Bacteria 20297
2602 Ga0495625_0011359 3300046660 Bacteria 7269
2603 Ga0495625_0017857 3300046660 Bacteria 5545
2604 Ga0495625_0021370 3300046660 Bacteria 4985
2605 Ga0495625_0062942 3300046660 Bacteria 2621
2606 Ga0495635_0000499 3300046663 Bacteria 24785
2607 Ga0495635_0002467 3300046663 Bacteria 12629
2608 Ga0495635_0007327 3300046663 Bacteria 7700
2609 Ga0495635_0015679 3300046663 Bacteria 5293
2610 Ga0495635_0038692 3300046663 Bacteria 3301
2611 Ga0495659_0000507 3300046664 Bacteria 14341
2612 Ga0495659_0006904 3300046664 Bacteria 3592
2613 Ga0495661_0000508 3300046665 Bacteria 40445
2614 Ga0495661_0003743 3300046665 Bacteria 11137
2615 Ga0495661_0004508 3300046665 Bacteria 10034
2616 Ga0495661_0011425 3300046665 Bacteria 6027
2617 Ga0495661_0027671 3300046665 Bacteria 3637
2618 Ga0495588_0003821 3300046674 Bacteria 6598
2619 Ga0495657_0000547 3300046675 Bacteria 34712
2620 Ga0495657_0001713 3300046675 Bacteria 18808
2621 Ga0495657_0014998 3300046675 Bacteria 5683
2622 Ga0495657_0015382 3300046675 Bacteria 5601
2623 Ga0495657_0024698 3300046675 Bacteria 4275
2624 Ga0495657_0027870 3300046675 Bacteria 3979
2625 Ga0495657_0028717 3300046675 Bacteria 3908
2626 Ga0495657_0067075 3300046675 Bacteria 2356
2627 Ga0495599_0001467 3300046678 Bacteria 13533
2628 Ga0495599_0044444 3300046678 Bacteria 2785
2629 Ga0495599_0050542 3300046678 Bacteria 2605
2630 Ga0495623_0002970 3300046679 Bacteria 11156
2631 Ga0495623_0019420 3300046679 Bacteria 4393
2632 Ga0495623_0027732 3300046679 Bacteria 3646
2633 Ga0495623_0033370 3300046679 Bacteria 3303
2634 Ga0495646_0005997 3300046680 Bacteria 7702
2635 Ga0495646_0006642 3300046680 Bacteria 7336
2636 Ga0495646_0028721 3300046680 Bacteria 3481
2637 Ga0495646_0035084 3300046680 Bacteria 3112
2638 Ga0495646_0042584 3300046680 Bacteria 2785
2639 Ga0495658_0003975 3300046683 Bacteria 7289
2640 Ga0495669_0001613 3300046684 Bacteria 9257
2641 Ga0495669_0008442 3300046684 Bacteria 4332
2642 Ga0495613_0000311 3300046689 Bacteria 44152
2643 Ga0495613_0009170 3300046689 Bacteria 7334
2644 Ga0495613_0031726 3300046689 Bacteria 3924
2645 Ga0495613_0044701 3300046689 Bacteria 3275
2646 Ga0495613_0063955 3300046689 Bacteria 2691
2647 Ga0495624_0000172 3300046690 Bacteria 47939
2648 Ga0495624_0014596 3300046690 Bacteria 5324
2649 Ga0495624_0034753 3300046690 Bacteria 3258
2650 Ga0495670_0000020 3300046691 Bacteria 110171
2651 Ga0495670_0000089 3300046691 Bacteria 40658
2652 Ga0495670_0001902 3300046691 Bacteria 10295
2653 Ga0495671_0000005 3300046692 Bacteria 509397
2654 Ga0495671_0000034 3300046692 Bacteria 195385
2655 Ga0495671_0000788 3300046692 Bacteria 22740
2656 Ga0495671_0014991 3300046692 Bacteria 4163
2657 Ga0495649_0000140 3300046694 Bacteria 62872
2658 Ga0495649_0000511 3300046694 Bacteria 33219
2659 Ga0495649_0000655 3300046694 Bacteria 28205
2660 Ga0495649_0000890 3300046694 Bacteria 23784
2661 Ga0495649_0000932 3300046694 Bacteria 23147
2662 Ga0495649_0001761 3300046694 Bacteria 15965
2663 Ga0495649_0002309 3300046694 Bacteria 13533
2664 Ga0495649_0010831 3300046694 Bacteria 5371
2665 Ga0495649_0012790 3300046694 Bacteria 4866
2666 Ga0495649_0014064 3300046694 Bacteria 4597
2667 Ga0495649_0019593 3300046694 Bacteria 3801
2668 Ga0495649_0027043 3300046694 Bacteria 3184
2669 Ga0495589_0000170 3300046794 Bacteria 59283
2670 Ga0495589_0000404 3300046794 Bacteria 32498
2671 Ga0495589_0002333 3300046794 Bacteria 10666
2672 Ga0495589_0004544 3300046794 Bacteria 7371
2673 Ga0495589_0007104 3300046794 Bacteria 5869
2674 Ga0495600_0002404 3300046809 Bacteria 10725
2675 Ga0495600_0005116 3300046809 Bacteria 7882
2676 Ga0495600_0017162 3300046809 Bacteria 4601
2677 Ga0495600_0044179 3300046809 Bacteria 2907
2678 Ga0495600_0045316 3300046809 Bacteria 2869
2679 Ga0495660_0000127 3300046810 Bacteria 84034
2680 Ga0495660_0000372 3300046810 Bacteria 39338
2681 Ga0495660_0004162 3300046810 Bacteria 8800
2682 Ga0495660_0008310 3300046810 Bacteria 6078
2683 Ga0495660_0009316 3300046810 Bacteria 5727
2684 Ga0495660_0021275 3300046810 Bacteria 3714
2685 Ga0495660_0028490 3300046810 Bacteria 3155
2686 Ga0495660_0030508 3300046810 Bacteria 3036
2687 Ga0495581_0012327 3300047315 Bacteria 4952
2688 Ga0495604_0000049 3300047317 Bacteria 108620
2689 Ga0495604_0002863 3300047317 Bacteria 13833
2690 Ga0495604_0003848 3300047317 Bacteria 11954
2691 Ga0495604_0004754 3300047317 Bacteria 10757
2692 Ga0495604_0010087 3300047317 Bacteria 7480
2693 Ga0495604_0052012 3300047317 Bacteria 3173
2694 Ga0495636_0000216 3300047318 Bacteria 22661
2695 Ga0495636_0003297 3300047318 Bacteria 6255
2696 Ga0495674_0000020 3300047319 Bacteria 178465
2697 Ga0495674_0001538 3300047319 Bacteria 22536
2698 Ga0495674_0001845 3300047319 Bacteria 20870
2699 Ga0495674_0001880 3300047319 Bacteria 20675
2700 Ga0495674_0022761 3300047319 Bacteria 5775
2701 Ga0495674_0024333 3300047319 Bacteria 5565
2702 Ga0495674_0033954 3300047319 Bacteria 4616
2703 Ga0495674_0069561 3300047319 Bacteria 3043
2704 Ga0495674_0082203 3300047319 Bacteria 2762
2705 Ga0495672_0000013 3300047320 Bacteria 511827
2706 Ga0495672_0000174 3300047320 Bacteria 93615
2707 Ga0495672_0000530 3300047320 Bacteria 43361
2708 Ga0495672_0000648 3300047320 Bacteria 38622
2709 Ga0495672_0002584 3300047320 Bacteria 16441
2710 Ga0495672_0005425 3300047320 Bacteria 10120
2711 Ga0495672_0006208 3300047320 Bacteria 9319
2712 Ga0495672_0013647 3300047320 Bacteria 5592
2713 Ga0495672_0014521 3300047320 Bacteria 5390
2714 Ga0495672_0022835 3300047320 Bacteria 4060
2715 Ga0495676_0000058 3300047321 Bacteria 86045
2716 Ga0495676_0012393 3300047321 Bacteria 7680
2717 Ga0495676_0024197 3300047321 Bacteria 5260
2718 Ga0495676_0028024 3300047321 Bacteria 4819
2719 Ga0495676_0085445 3300047321 Bacteria 2377
2720 Ga0495680_0000977 3300047322 Bacteria 31770
2721 Ga0495680_0003381 3300047322 Bacteria 15762
2722 Ga0495680_0005627 3300047322 Bacteria 11740
2723 Ga0495680_0010275 3300047322 Bacteria 8350
2724 Ga0495680_0010996 3300047322 Bacteria 8040
2725 Ga0495680_0011914 3300047322 Bacteria 7673
2726 Ga0495680_0016012 3300047322 Bacteria 6450
2727 Ga0495680_0018084 3300047322 Bacteria 5998
2728 Ga0495680_0022696 3300047322 Bacteria 5228
2729 Ga0495680_0025246 3300047322 Bacteria 4920
2730 Ga0495680_0049640 3300047322 Bacteria 3286
2731 Ga0495683_0000006 3300047323 Bacteria 272409
2732 Ga0495683_0000007 3300047323 Bacteria 268546
2733 Ga0495683_0000181 3300047323 Bacteria 61963
2734 Ga0495683_0000594 3300047323 Bacteria 27203
2735 Ga0495683_0001052 3300047323 Bacteria 19204
2736 Ga0495683_0009884 3300047323 Bacteria 5069
2737 Ga0495683_0014253 3300047323 Bacteria 4141
2738 Ga0495683_0017841 3300047323 Bacteria 3675
2739 Ga0495683_0033338 3300047323 Bacteria 2620
2740 Ga0495687_000004 3300047443 Bacteria 779298
2741 Ga0495687_000103 3300047443 Bacteria 128840
2742 Ga0495687_000797 3300047443 Bacteria 33934
2743 Ga0495687_001002 3300047443 Bacteria 28208
2744 Ga0495675_0000062 3300047444 Bacteria 75661
2745 Ga0495675_0000155 3300047444 Bacteria 48300
2746 Ga0495675_0008068 3300047444 Bacteria 6518
2747 Ga0495675_0017580 3300047444 Bacteria 4533
2748 Ga0495675_0022730 3300047444 Bacteria 3998
2749 Ga0495675_0024920 3300047444 Bacteria 3816
2750 Ga0495679_000008 3300047446 Bacteria 367186
2751 Ga0495679_000555 3300047446 Bacteria 26268
2752 Ga0495679_000612 3300047446 Bacteria 24130
2753 Ga0495679_001722 3300047446 Bacteria 12100
2754 Ga0495679_006187 3300047446 Bacteria 5198
2755 Ga0495685_000006 3300047447 Bacteria 110665
2756 Ga0495673_0000009 3300047469 Bacteria 731993
2757 Ga0495673_0000013 3300047469 Bacteria 612902
2758 Ga0495673_0001734 3300047469 Bacteria 16659
2759 Ga0495673_0002039 3300047469 Bacteria 14802
2760 Ga0495673_0005017 3300047469 Bacteria 8120
2761 Ga0495681_0000231 3300047470 Bacteria 46423
2762 Ga0495681_0000655 3300047470 Bacteria 26339
2763 Ga0495681_0001456 3300047470 Bacteria 17706
2764 Ga0495681_0003068 3300047470 Bacteria 11719
2765 Ga0495681_0003977 3300047470 Bacteria 10172
2766 Ga0495681_0005691 3300047470 Bacteria 8298
2767 Ga0495681_0015678 3300047470 Bacteria 4279
2768 Ga0495684_0001474 3300047471 Bacteria 18835
2769 Ga0495684_0005106 3300047471 Bacteria 10237
2770 Ga0495684_0010906 3300047471 Bacteria 7026
2771 Ga0495684_0013571 3300047471 Bacteria 6272
2772 Ga0495684_0026050 3300047471 Bacteria 4495
2773 Ga0495684_0027848 3300047471 Bacteria 4340
2774 Ga0495684_0055832 3300047471 Bacteria 3011
2775 Ga0495686_0000008 3300047472 Bacteria 727479
2776 Ga0495686_0000140 3300047472 Bacteria 144956
2777 Ga0495686_0000266 3300047472 Bacteria 93781
2778 Ga0495686_0002955 3300047472 Bacteria 15191
2779 Ga0495686_0006716 3300047472 Bacteria 8749
2780 Ga0495686_0008786 3300047472 Bacteria 7362
2781 Ga0495686_0015818 3300047472 Bacteria 5134
2782 Ga0495686_0020788 3300047472 Bacteria 4373
2783 Ga0495686_0021963 3300047472 Bacteria 4226
2784 Ga0495686_0080760 3300047472 Bacteria 1987
2785 Ga0495593_0000492 3300047673 Bacteria 22255
2786 Ga0495593_0002655 3300047673 Bacteria 10750
2787 Ga0495593_0011188 3300047673 Bacteria 5159
2788 Ga0495593_0011838 3300047673 Bacteria 5003
2789 Ga0495593_0019333 3300047673 Bacteria 3819
2790 Ga0495602_0000558 3300048088 Bacteria 34735
2791 Ga0495602_0000750 3300048088 Bacteria 30821
2792 Ga0495602_0004231 3300048088 Bacteria 14936
2793 Ga0495602_0010916 3300048088 Bacteria 9413
2794 Ga0495602_0013660 3300048088 Bacteria 8285
2795 Ga0495602_0028661 3300048088 Bacteria 5323
2796 Ga0495602_0043688 3300048088 Bacteria 4071
2797 Ga0495602_0100264 3300048088 Bacteria 2378
2798 Ga0495614_0009874 3300048089 Bacteria 4213
2799 Ga0495614_0037464 3300048089 Bacteria 2080
2800 Ga0495615_0000035 3300048090 Bacteria 44887
2801 Ga0495626_0000025 3300048091 Bacteria 209356
2802 Ga0495626_0000097 3300048091 Bacteria 113925
2803 Ga0495626_0000479 3300048091 Bacteria 40352
2804 Ga0495626_0000531 3300048091 Bacteria 37903
2805 Ga0495626_0001572 3300048091 Bacteria 17894
2806 Ga0495626_0016297 3300048091 Bacteria 3777
2807 Ga0495626_0023530 3300048091 Bacteria 3032
2808 Ga0496100_0002705 3300048903 Bacteria 9056
2809 Ga0496100_0020728 3300048903 Bacteria 3947
2810 Ga0496100_0022455 3300048903 Bacteria 3818
2811 Ga0496100_0040746 3300048903 Bacteria 2957
2812 Ga0496101_0000074 3300048904 Bacteria 113105
2813 Ga0496101_0000375 3300048904 Bacteria 29651
2814 Ga0496101_0006659 3300048904 Bacteria 7451
2815 Ga0496101_0006671 3300048904 Bacteria 7443
2816 Ga0496101_0036313 3300048904 Bacteria 3490
2817 Ga0496101_0039423 3300048904 Bacteria 3359
2818 Ga0496101_0053503 3300048904 Bacteria 2913
2819 Ga0496101_0079730 3300048904 Bacteria 2417
2820 Ga0496102_0000015 3300048905 Bacteria 304524
2821 Ga0496102_0000891 3300048905 Bacteria 28311
2822 Ga0496102_0001730 3300048905 Bacteria 19110
2823 Ga0496102_0002503 3300048905 Bacteria 15690
2824 Ga0496102_0006621 3300048905 Bacteria 9900
2825 Ga0496102_0009367 3300048905 Bacteria 8413
2826 Ga0496102_0012819 3300048905 Bacteria 7258
2827 Ga0496102_0017696 3300048905 Bacteria 6247
2828 Ga0496102_0026802 3300048905 Bacteria 5144
2829 Ga0496102_0029055 3300048905 Bacteria 4943
2830 Ga0496102_0031159 3300048905 Bacteria 4781
2831 Ga0496102_0042322 3300048905 Bacteria 4127
2832 Ga0496102_0052166 3300048905 Bacteria 3725
2833 Ga0496102_0059033 3300048905 Bacteria 3507
2834 Ga0496102_0072352 3300048905 Bacteria 3168
2835 Ga0496102_0125846 3300048905 Bacteria 2395
2836 Ga0496103_0000020 3300048906 Bacteria 234050
2837 Ga0496103_0000084 3300048906 Bacteria 105728
2838 Ga0496103_0000866 3300048906 Bacteria 22006
2839 Ga0496103_0002826 3300048906 Bacteria 10791
2840 Ga0496103_0010227 3300048906 Bacteria 5549
2841 Ga0496103_0027890 3300048906 Bacteria 3425
2842 Ga0496103_0029152 3300048906 Bacteria 3353
2843 Ga0496104_0000165 3300048907 Bacteria 58816
2844 Ga0496104_0007065 3300048907 Bacteria 9902
2845 Ga0496104_0011663 3300048907 Bacteria 7878
2846 Ga0496104_0019504 3300048907 Bacteria 6206
2847 Ga0496104_0023136 3300048907 Bacteria 5712
2848 Ga0496104_0029164 3300048907 Bacteria 5117
2849 Ga0496104_0036140 3300048907 Bacteria 4616
2850 Ga0496104_0039290 3300048907 Bacteria 4430
2851 Ga0496104_0052479 3300048907 Bacteria 3851
2852 Ga0496105_0001670 3300048908 Bacteria 15805
2853 Ga0496105_0005065 3300048908 Bacteria 9982
2854 Ga0496105_0006606 3300048908 Bacteria 8931
2855 Ga0496105_0009075 3300048908 Bacteria 7757
2856 Ga0496105_0017774 3300048908 Bacteria 5703
2857 Ga0496105_0022147 3300048908 Bacteria 5147
2858 Ga0496105_0046663 3300048908 Bacteria 3575
2859 Ga0496105_0050742 3300048908 Bacteria 3427
2860 Ga0496106_0000075 3300048909 Bacteria 79842
2861 Ga0496106_0000960 3300048909 Bacteria 21012
2862 Ga0496106_0003049 3300048909 Bacteria 12484
2863 Ga0496106_0007594 3300048909 Bacteria 8019
2864 Ga0496106_0010201 3300048909 Bacteria 6942
2865 Ga0496106_0025825 3300048909 Bacteria 4371
2866 Ga0496106_0031424 3300048909 Bacteria 3957
2867 Ga0496106_0035097 3300048909 Bacteria 3749
2868 Ga0496106_0044721 3300048909 Bacteria 3324
2869 Ga0496107_0001771 3300048910 Bacteria 13603
2870 Ga0496107_0009639 3300048910 Bacteria 6696
2871 Ga0496107_0020479 3300048910 Bacteria 4672
2872 Ga0496107_0030509 3300048910 Bacteria 3843
2873 Ga0496107_0062004 3300048910 Bacteria 2708
2874 Ga0496107_0081289 3300048910 Bacteria 2363
2875 Ga0496107_0101933 3300048910 Bacteria 2105
2876 Ga0496108_0000003 3300048911 Bacteria 595687
2877 Ga0496108_0000534 3300048911 Bacteria 29627
2878 Ga0496108_0005091 3300048911 Bacteria 10622
2879 Ga0496108_0026087 3300048911 Bacteria 4819
2880 Ga0496108_0043966 3300048911 Bacteria 3730
2881 Ga0496109_0000820 3300048912 Bacteria 25931
2882 Ga0496109_0002591 3300048912 Bacteria 15144
2883 Ga0496109_0002738 3300048912 Bacteria 14779
2884 Ga0496109_0025719 3300048912 Bacteria 5246
2885 Ga0496109_0027212 3300048912 Bacteria 5104
2886 Ga0496109_0033194 3300048912 Bacteria 4643
2887 Ga0496109_0038943 3300048912 Bacteria 4301
2888 Ga0496109_0043791 3300048912 Bacteria 4058
2889 Ga0496109_0074022 3300048912 Bacteria 3130
2890 Ga0496109_0171041 3300048912 Bacteria 2038
2891 Ga0496110_0000374 3300048913 Bacteria 29938
2892 Ga0496110_0003347 3300048913 Bacteria 12253
2893 Ga0496110_0006293 3300048913 Bacteria 9372
2894 Ga0496110_0006355 3300048913 Bacteria 9342
2895 Ga0496110_0014733 3300048913 Bacteria 6498
2896 Ga0496110_0021566 3300048913 Bacteria 5457
2897 Ga0496110_0028434 3300048913 Bacteria 4802
2898 Ga0496110_0046471 3300048913 Bacteria 3799
2899 Ga0496110_0052360 3300048913 Bacteria 3587
2900 Ga0496110_0074456 3300048913 Bacteria 3016
2901 Ga0496111_0006277 3300048914 Bacteria 7707
2902 Ga0496111_0009479 3300048914 Bacteria 6501
2903 Ga0496111_0020535 3300048914 Bacteria 4599
2904 Ga0496111_0053027 3300048914 Bacteria 2929
2905 Ga0496112_0010375 3300048915 Bacteria 8447
2906 Ga0496112_0022446 3300048915 Bacteria 6015
2907 Ga0496112_0023925 3300048915 Bacteria 5843
2908 Ga0496113_0012154 3300048916 Bacteria 5777
2909 Ga0496113_0016217 3300048916 Bacteria 5143
2910 Ga0496113_0016757 3300048916 Bacteria 5068
2911 Ga0496113_0017906 3300048916 Bacteria 4925
2912 Ga0496113_0018517 3300048916 Bacteria 4852
2913 Ga0496114_0000455 3300048917 Bacteria 30109
2914 Ga0496114_0000817 3300048917 Bacteria 23337
2915 Ga0496114_0003071 3300048917 Bacteria 12796
2916 Ga0496114_0003887 3300048917 Bacteria 11517
2917 Ga0496114_0006067 3300048917 Bacteria 9509
2918 Ga0496114_0007202 3300048917 Bacteria 8780
2919 Ga0496114_0013508 3300048917 Bacteria 6549
2920 Ga0496114_0017272 3300048917 Bacteria 5822
2921 Ga0496114_0022580 3300048917 Bacteria 5128
2922 Ga0496114_0024244 3300048917 Bacteria 4950
2923 Ga0496114_0025467 3300048917 Bacteria 4836
2924 Ga0496114_0030606 3300048917 Bacteria 4429
2925 Ga0496114_0031744 3300048917 Bacteria 4345
2926 Ga0496115_0000013 3300048918 Bacteria 213060
2927 Ga0496115_0000033 3300048918 Bacteria 136223
2928 Ga0496115_0000234 3300048918 Bacteria 50391
2929 Ga0496115_0005234 3300048918 Bacteria 9427
2930 Ga0496115_0009074 3300048918 Bacteria 7378
2931 Ga0496115_0013662 3300048918 Bacteria 6146
2932 Ga0496115_0026308 3300048918 Bacteria 4540
2933 Ga0496115_0037996 3300048918 Bacteria 3819
2934 Ga0496115_0038523 3300048918 Bacteria 3793
2935 Ga0496116_0000099 3300048919 Bacteria 195607
2936 Ga0496116_0000139 3300048919 Bacteria 151501
2937 Ga0496116_0000255 3300048919 Bacteria 94048
2938 Ga0496116_0002999 3300048919 Bacteria 17122
2939 Ga0496116_0005991 3300048919 Bacteria 11147
2940 Ga0496116_0007951 3300048919 Bacteria 9292
2941 Ga0496117_0000047 3300048920 Bacteria 299632
2942 Ga0496117_0000123 3300048920 Bacteria 169805
2943 Ga0496117_0000475 3300048920 Bacteria 66690
2944 Ga0496117_0000851 3300048920 Bacteria 47282
2945 Ga0496117_0001510 3300048920 Bacteria 33334
2946 Ga0496117_0004831 3300048920 Bacteria 14569
2947 Ga0496117_0015243 3300048920 Bacteria 6569
2948 Ga0496117_0039234 3300048920 Bacteria 3497
2949 Ga0496117_0047987 3300048920 Bacteria 3055
2950 Ga0496117_0048851 3300048920 Bacteria 3016
2951 Ga0496117_0069437 3300048920 Bacteria 2372
2952 Ga0496118_0000050 3300048921 Bacteria 244124
2953 Ga0496118_0000180 3300048921 Bacteria 112199
2954 Ga0496118_0000482 3300048921 Bacteria 66218
2955 Ga0496118_0001956 3300048921 Bacteria 29198
2956 Ga0496118_0002472 3300048921 Bacteria 24811
2957 Ga0496118_0003946 3300048921 Bacteria 18139
2958 Ga0496118_0004382 3300048921 Bacteria 16784
2959 Ga0496118_0010557 3300048921 Bacteria 9131
2960 Ga0496118_0015887 3300048921 Bacteria 6938
2961 Ga0496118_0032782 3300048921 Bacteria 4272
2962 Ga0496118_0042334 3300048921 Bacteria 3594
2963 Ga0496118_0046240 3300048921 Bacteria 3388
2964 Ga0496118_0066316 3300048921 Bacteria 2636
2965 Ga0496118_0102605 3300048921 Bacteria 1927
2966 Ga0496119_0000121 3300048922 Bacteria 109164
2967 Ga0496119_0001262 3300048922 Bacteria 31460
2968 Ga0496119_0001894 3300048922 Bacteria 24029
2969 Ga0496119_0002030 3300048922 Bacteria 22904
2970 Ga0496119_0004217 3300048922 Bacteria 14432
2971 Ga0496119_0006846 3300048922 Bacteria 10433
2972 Ga0496119_0029783 3300048922 Bacteria 3692
2973 Ga0496120_0000015 3300048923 Bacteria 310795
2974 Ga0496120_0002847 3300048923 Bacteria 16665
2975 Ga0496120_0003407 3300048923 Bacteria 14541
2976 Ga0496120_0011569 3300048923 Bacteria 6060
2977 Ga0496121_0000014 3300048924 Bacteria 609379
2978 Ga0496121_0000229 3300048924 Bacteria 120626
2979 Ga0496121_0000423 3300048924 Bacteria 83271
2980 Ga0496121_0000535 3300048924 Bacteria 72199
2981 Ga0496121_0000697 3300048924 Bacteria 62465
2982 Ga0496121_0001534 3300048924 Bacteria 38645
2983 Ga0496121_0002341 3300048924 Bacteria 29255
2984 Ga0496121_0002903 3300048924 Bacteria 25156
2985 Ga0496121_0003987 3300048924 Bacteria 20365
2986 Ga0496121_0004070 3300048924 Bacteria 20079
2987 Ga0496121_0004671 3300048924 Bacteria 18187
2988 Ga0496121_0006852 3300048924 Bacteria 13928
2989 Ga0496121_0028530 3300048924 Bacteria 5192
2990 Ga0496121_0031005 3300048924 Bacteria 4897
2991 Ga0496121_0033075 3300048924 Bacteria 4687
2992 Ga0496121_0046171 3300048924 Bacteria 3731
2993 Ga0496122_0000032 3300048925 Bacteria 327099
2994 Ga0496122_0000097 3300048925 Bacteria 199223
2995 Ga0496122_0000137 3300048925 Bacteria 170016
2996 Ga0496122_0000221 3300048925 Bacteria 127004
2997 Ga0496122_0000725 3300048925 Bacteria 64489
2998 Ga0496122_0001675 3300048925 Bacteria 34384
2999 Ga0496122_0003392 3300048925 Bacteria 20972
3000 Ga0496122_0004898 3300048925 Bacteria 16240
3001 Ga0496122_0007329 3300048925 Bacteria 12317
3002 Ga0496122_0009727 3300048925 Bacteria 10049
3003 Ga0496122_0011400 3300048925 Bacteria 9007
3004 Ga0496123_0000022 3300048926 Bacteria 361832
3005 Ga0496123_0000093 3300048926 Bacteria 179205
3006 Ga0496123_0000429 3300048926 Bacteria 75585
3007 Ga0496123_0000967 3300048926 Bacteria 44394
3008 Ga0496123_0000989 3300048926 Bacteria 43699
3009 Ga0496123_0002260 3300048926 Bacteria 24277
3010 Ga0496123_0003395 3300048926 Bacteria 17945
3011 Ga0496123_0003987 3300048926 Bacteria 15989
3012 Ga0496123_0005741 3300048926 Bacteria 12356
3013 Ga0496123_0007807 3300048926 Bacteria 9961
3014 Ga0496123_0008195 3300048926 Bacteria 9636
3015 Ga0496123_0008283 3300048926 Bacteria 9577
3016 Ga0496123_0020339 3300048926 Bacteria 5195
3017 Ga0496123_0059977 3300048926 Bacteria 2455
3018 Ga0496124_0000001 3300048927 Bacteria 1747840
3019 Ga0496124_0000019 3300048927 Bacteria 436995
3020 Ga0496124_0000383 3300048927 Bacteria 80834
3021 Ga0496124_0000567 3300048927 Bacteria 62492
3022 Ga0496124_0000799 3300048927 Bacteria 51168
3023 Ga0496124_0001996 3300048927 Bacteria 27794
3024 Ga0496124_0002309 3300048927 Bacteria 25181
3025 Ga0496124_0003593 3300048927 Bacteria 18847
3026 Ga0496124_0003997 3300048927 Bacteria 17564
3027 Ga0496124_0006000 3300048927 Bacteria 13396
3028 Ga0496124_0007199 3300048927 Bacteria 11891
3029 Ga0496124_0008901 3300048927 Bacteria 10408
3030 Ga0496124_0020138 3300048927 Bacteria 6176
3031 Ga0496124_0021395 3300048927 Bacteria 5961
3032 Ga0496124_0032888 3300048927 Bacteria 4572
3033 Ga0496124_0049566 3300048927 Bacteria 3581
3034 Ga0496124_0058597 3300048927 Bacteria 3238
3035 Ga0496124_0058932 3300048927 Bacteria 3227
3036 Ga0496125_0000014 3300048928 Bacteria 610124
3037 Ga0496125_0000041 3300048928 Bacteria 310158
3038 Ga0496125_0000317 3300048928 Bacteria 94000
3039 Ga0496125_0001963 3300048928 Bacteria 28012
3040 Ga0496125_0003502 3300048928 Bacteria 18955
3041 Ga0496125_0006562 3300048928 Bacteria 12536
3042 Ga0496125_0008776 3300048928 Bacteria 10513
3043 Ga0496125_0013729 3300048928 Bacteria 7944
3044 Ga0496125_0028098 3300048928 Bacteria 5086
3045 Ga0496125_0064749 3300048928 Bacteria 2902
3046 Ga0496126_0000017 3300048929 Bacteria 610676
3047 Ga0496126_0000045 3300048929 Bacteria 331225
3048 Ga0496126_0000049 3300048929 Bacteria 317568
3049 Ga0496126_0000095 3300048929 Bacteria 207654
3050 Ga0496126_0000335 3300048929 Bacteria 99038
3051 Ga0496126_0000340 3300048929 Bacteria 98226
3052 Ga0496126_0003390 3300048929 Bacteria 20169
3053 Ga0496126_0004741 3300048929 Bacteria 16038
3054 Ga0496126_0007045 3300048929 Bacteria 12398
3055 Ga0496126_0012041 3300048929 Bacteria 8888
3056 Ga0496126_0012351 3300048929 Bacteria 8758
3057 Ga0496126_0015370 3300048929 Bacteria 7700
3058 Ga0496126_0016664 3300048929 Bacteria 7343
3059 Ga0496126_0024420 3300048929 Bacteria 5837
3060 Ga0496126_0074758 3300048929 Bacteria 3008
3061 Ga0496126_0101002 3300048929 Bacteria 2524
3062 Ga0495678_000056 3300049459 Bacteria 149598
3063 Ga0495678_000222 3300049459 Bacteria 65798
3064 Ga0495678_001846 3300049459 Bacteria 15494
3065 Ga0495678_001994 3300049459 Bacteria 14674
3066 Ga0495678_005108 3300049459 Bacteria 7371
3067 Ga0495678_008462 3300049459 Bacteria 5186
3068 Ga0495678_011186 3300049459 Bacteria 4312
3069 Ga0495678_014469 3300049459 Bacteria 3668
3070 Ga0495682_0000425 3300049460 Bacteria 29587
3071 Ga0495682_0007862 3300049460 Bacteria 4217
3072 Ga0495682_0022865 3300049460 Bacteria 2336
3073 Ga0501031_0000023 3300049568 Bacteria 90377
3074 Ga0501031_0002467 3300049568 Bacteria 11802
3075 Ga0501031_0005801 3300049568 Bacteria 8047
3076 Ga0501031_0031643 3300049568 Bacteria 3451
3077 Ga0501031_0065629 3300049568 Bacteria 2365
3078 Ga0501032_0000546 3300049569 Bacteria 30501
3079 Ga0501032_0001825 3300049569 Bacteria 16837
3080 Ga0501032_0004032 3300049569 Bacteria 11139
3081 Ga0501032_0005036 3300049569 Bacteria 9877
3082 Ga0501032_0006453 3300049569 Bacteria 8628
3083 Ga0501032_0008641 3300049569 Bacteria 7422
3084 Ga0501032_0018962 3300049569 Bacteria 4813
3085 Ga0501032_0019350 3300049569 Bacteria 4763
3086 Ga0501032_0022378 3300049569 Bacteria 4382
3087 Ga0501032_0039383 3300049569 Bacteria 3215
3088 Ga0501033_0000245 3300049570 Bacteria 52188
3089 Ga0501033_0001226 3300049570 Bacteria 23025
3090 Ga0501033_0001235 3300049570 Bacteria 22939
3091 Ga0501033_0004451 3300049570 Bacteria 11206
3092 Ga0501033_0007011 3300049570 Bacteria 8799
3093 Ga0501033_0011502 3300049570 Bacteria 6774
3094 Ga0501033_0012959 3300049570 Bacteria 6359
3095 Ga0501033_0044729 3300049570 Bacteria 3295
3096 Ga0501034_0000158 3300049571 Bacteria 128537
3097 Ga0501034_0000523 3300049571 Bacteria 61646
3098 Ga0501034_0001507 3300049571 Bacteria 30558
3099 Ga0501034_0002044 3300049571 Bacteria 25331
3100 Ga0501034_0002536 3300049571 Bacteria 21841
3101 Ga0501034_0002989 3300049571 Bacteria 19572
3102 Ga0501034_0003113 3300049571 Bacteria 19113
3103 Ga0501034_0008106 3300049571 Bacteria 11143
3104 Ga0501034_0008695 3300049571 Bacteria 10694
3105 Ga0501034_0011443 3300049571 Bacteria 9191
3106 Ga0501034_0014180 3300049571 Bacteria 8215
3107 Ga0501034_0022121 3300049571 Bacteria 6477
3108 Ga0501034_0030552 3300049571 Bacteria 5476
3109 Ga0501034_0032444 3300049571 Bacteria 5304
3110 Ga0501034_0041878 3300049571 Bacteria 4634
3111 Ga0501034_0052709 3300049571 Bacteria 4098
3112 Ga0501034_0069699 3300049571 Bacteria 3527
3113 Ga0501034_0075355 3300049571 Bacteria 3382
3114 Ga0501034_0089977 3300049571 Bacteria 3068
3115 Ga0501034_0100606 3300049571 Bacteria 2885
3116 Ga0501036_0000277 3300049572 Bacteria 35238
3117 Ga0501036_0001029 3300049572 Bacteria 21072
3118 Ga0501036_0048548 3300049572 Bacteria 3594
3119 Ga0501036_0059229 3300049572 Bacteria 3245
3120 Ga0501036_0070590 3300049572 Bacteria 2953
3121 Ga0501037_0000709 3300049573 Bacteria 25325
3122 Ga0501037_0000838 3300049573 Bacteria 22953
3123 Ga0501037_0001324 3300049573 Bacteria 18177
3124 Ga0501037_0008605 3300049573 Bacteria 7485
3125 Ga0501037_0010971 3300049573 Bacteria 6662
3126 Ga0501037_0033196 3300049573 Bacteria 3812
3127 Ga0501037_0035378 3300049573 Bacteria 3683
3128 Ga0501037_0055024 3300049573 Bacteria 2910
3129 Ga0501038_0000030 3300049574 Bacteria 132455
3130 Ga0501038_0002532 3300049574 Bacteria 17039
3131 Ga0501038_0005372 3300049574 Bacteria 11900
3132 Ga0501038_0007617 3300049574 Bacteria 9983
3133 Ga0501038_0012970 3300049574 Bacteria 7603
3134 Ga0501038_0031302 3300049574 Bacteria 4702
3135 Ga0501038_0032402 3300049574 Bacteria 4611
3136 Ga0501038_0032550 3300049574 Bacteria 4599
3137 Ga0501038_0037305 3300049574 Bacteria 4261
3138 Ga0501038_0040154 3300049574 Bacteria 4089
3139 Ga0501038_0046680 3300049574 Bacteria 3754
3140 Ga0501038_0082978 3300049574 Bacteria 2698
3141 Ga0501039_0000733 3300049575 Bacteria 23645
3142 Ga0501039_0001120 3300049575 Bacteria 19696
3143 Ga0501039_0001378 3300049575 Bacteria 17825
3144 Ga0501039_0002089 3300049575 Bacteria 14805
3145 Ga0501039_0038445 3300049575 Bacteria 3696
3146 Ga0501039_0047992 3300049575 Bacteria 3300
3147 Ga0501039_0075050 3300049575 Bacteria 2628
3148 Ga0501040_0041771 3300049576 Bacteria 3124
3149 Ga0501041_0006009 3300049577 Bacteria 7103
3150 Ga0501041_0032700 3300049577 Bacteria 3144
3151 Ga0501042_0004251 3300049578 Bacteria 9113
3152 Ga0501042_0004748 3300049578 Bacteria 8676
3153 Ga0501042_0008803 3300049578 Bacteria 6692
3154 Ga0501042_0022853 3300049578 Bacteria 4369
3155 Ga0501042_0027026 3300049578 Bacteria 4034
3156 Ga0501043_0000043 3300049579 Bacteria 115410
3157 Ga0501043_0001195 3300049579 Bacteria 22851
3158 Ga0501043_0001589 3300049579 Bacteria 19750
3159 Ga0501043_0001903 3300049579 Bacteria 17889
3160 Ga0501043_0002267 3300049579 Bacteria 16355
3161 Ga0501043_0003998 3300049579 Bacteria 12066
3162 Ga0501043_0006011 3300049579 Bacteria 9762
3163 Ga0501043_0008733 3300049579 Bacteria 7975
3164 Ga0501043_0018014 3300049579 Bacteria 5540
3165 Ga0501043_0026983 3300049579 Bacteria 4507
3166 Ga0501043_0031484 3300049579 Bacteria 4169
3167 Ga0501043_0059147 3300049579 Bacteria 3007
3168 Ga0501043_0060924 3300049579 Bacteria 2963
3169 Ga0501043_0064550 3300049579 Bacteria 2875
3170 Ga0501046_0000714 3300049580 Bacteria 32091
3171 Ga0501046_0007718 3300049580 Bacteria 9432
3172 Ga0501046_0011141 3300049580 Bacteria 7702
3173 Ga0501046_0060870 3300049580 Bacteria 2953
3174 Ga0501047_0000110 3300049581 Bacteria 99745
3175 Ga0501047_0000185 3300049581 Bacteria 75684
3176 Ga0501047_0001056 3300049581 Bacteria 27470
3177 Ga0501047_0007121 3300049581 Bacteria 10504
3178 Ga0501047_0008509 3300049581 Bacteria 9678
3179 Ga0501047_0009993 3300049581 Bacteria 8969
3180 Ga0501047_0010641 3300049581 Bacteria 8696
3181 Ga0501047_0010690 3300049581 Bacteria 8672
3182 Ga0501047_0026312 3300049581 Bacteria 5597
3183 Ga0501047_0031114 3300049581 Bacteria 5147
3184 Ga0501047_0039504 3300049581 Bacteria 4564
3185 Ga0501047_0080000 3300049581 Bacteria 3141
3186 Ga0501047_0100805 3300049581 Bacteria 2767
3187 Ga0501048_0000641 3300049582 Bacteria 25078
3188 Ga0501048_0000661 3300049582 Bacteria 24884
3189 Ga0501048_0014258 3300049582 Bacteria 5887
3190 Ga0501048_0014635 3300049582 Bacteria 5806
3191 Ga0501048_0028332 3300049582 Bacteria 4065
3192 Ga0501048_0046570 3300049582 Bacteria 3095
3193 Ga0501067_0000259 3300049583 Bacteria 28905
3194 Ga0501067_0000550 3300049583 Bacteria 20334
3195 Ga0501067_0013282 3300049583 Bacteria 4561
3196 Ga0501067_0015504 3300049583 Bacteria 4218
3197 Ga0501068_0001945 3300049584 Bacteria 10982
3198 Ga0501068_0006918 3300049584 Bacteria 6274
3199 Ga0501068_0024669 3300049584 Bacteria 3532
3200 Ga0501068_0026310 3300049584 Bacteria 3426
3201 Ga0501069_0000596 3300049585 Bacteria 16668
3202 Ga0501069_0009497 3300049585 Bacteria 5135
3203 Ga0501069_0054635 3300049585 Bacteria 2224
3204 Ga0501070_0000091 3300049586 Bacteria 77270
3205 Ga0501070_0002308 3300049586 Bacteria 16741
3206 Ga0501070_0003609 3300049586 Bacteria 13381
3207 Ga0501070_0006448 3300049586 Bacteria 9990
3208 Ga0501070_0006696 3300049586 Bacteria 9814
3209 Ga0501070_0008364 3300049586 Bacteria 8743
3210 Ga0501070_0011567 3300049586 Bacteria 7450
3211 Ga0501070_0020666 3300049586 Bacteria 5523
3212 Ga0501070_0023055 3300049586 Bacteria 5213
3213 Ga0501070_0023294 3300049586 Bacteria 5186
3214 Ga0501070_0023509 3300049586 Bacteria 5162
3215 Ga0501070_0025443 3300049586 Bacteria 4964
3216 Ga0501070_0050432 3300049586 Bacteria 3455
3217 Ga0501070_0054538 3300049586 Bacteria 3315
3218 Ga0501071_0006081 3300049587 Bacteria 7823
3219 Ga0501071_0006615 3300049587 Bacteria 7531
3220 Ga0501071_0008639 3300049587 Bacteria 6734
3221 Ga0501072_0000676 3300049588 Bacteria 24662
3222 Ga0501072_0003419 3300049588 Bacteria 11958
3223 Ga0501072_0012542 3300049588 Bacteria 6480
3224 Ga0501072_0064230 3300049588 Bacteria 2895
3225 Ga0501073_0000031 3300049589 Bacteria 114348
3226 Ga0501073_0001659 3300049589 Bacteria 16509
3227 Ga0501073_0003905 3300049589 Bacteria 11195
3228 Ga0501073_0011609 3300049589 Bacteria 6437
3229 Ga0501073_0016100 3300049589 Bacteria 5421
3230 Ga0501073_0016810 3300049589 Bacteria 5300
3231 Ga0501074_0000276 3300049590 Bacteria 29509
3232 Ga0501074_0002015 3300049590 Bacteria 13995
3233 Ga0501074_0002814 3300049590 Bacteria 12174
3234 Ga0501074_0006125 3300049590 Bacteria 8688
3235 Ga0501074_0008301 3300049590 Bacteria 7529
3236 Ga0501074_0016024 3300049590 Bacteria 5447
3237 Ga0501074_0022659 3300049590 Bacteria 4565
3238 Ga0501074_0025009 3300049590 Bacteria 4338
3239 Ga0501075_0000136 3300049591 Bacteria 36442
3240 Ga0501075_0008181 3300049591 Bacteria 7283
3241 Ga0501075_0053256 3300049591 Bacteria 3044
3242 Ga0501076_0000016 3300049592 Bacteria 94865
3243 Ga0501076_0018824 3300049592 Bacteria 5269
3244 Ga0501077_0000024 3300049593 Bacteria 76422
3245 Ga0501077_0001451 3300049593 Bacteria 14287
3246 Ga0501077_0006169 3300049593 Bacteria 7320
3247 Ga0501077_0014142 3300049593 Bacteria 5008
3248 Ga0501077_0044607 3300049593 Bacteria 2816
3249 Ga0501249_000066 3300049679 Bacteria 37481
3250 Ga0501249_000074 3300049679 Bacteria 34243
3251 Ga0501249_000186 3300049679 Bacteria 19016
3252 Ga0501257_000036 3300049686 Bacteria 38192
3253 Ga0501257_000673 3300049686 Bacteria 6821
3254 Ga0501229_001004 3300049706 Bacteria 3221
3255 Ga0501079_0003173 3300049741 Bacteria 12041
3256 Ga0501079_0014455 3300049741 Bacteria 6019
3257 Ga0501079_0037423 3300049741 Bacteria 3740
3258 Ga0501080_0001343 3300049742 Bacteria 20525
3259 Ga0501080_0008495 3300049742 Bacteria 9310
3260 Ga0501080_0011528 3300049742 Bacteria 8095
3261 Ga0501080_0034133 3300049742 Bacteria 4748
3262 Ga0501080_0040514 3300049742 Bacteria 4344
3263 Ga0501080_0047382 3300049742 Bacteria 4001
3264 Ga0501080_0068525 3300049742 Bacteria 3300
3265 Ga0501080_0117132 3300049742 Bacteria 2469
3266 Ga0501080_0142810 3300049742 Bacteria 2213
3267 Ga0501081_0013418 3300049743 Bacteria 5388
3268 Ga0501083_0000057 3300049744 Bacteria 81628
3269 Ga0501083_0000088 3300049744 Bacteria 62556
3270 Ga0501083_0004326 3300049744 Bacteria 10003
3271 Ga0501083_0004641 3300049744 Bacteria 9702
3272 Ga0501083_0004750 3300049744 Bacteria 9597
3273 Ga0501083_0009443 3300049744 Bacteria 6889
3274 Ga0501083_0028576 3300049744 Bacteria 3842
3275 Ga0501267_000733 3300049764 Bacteria 2643
3276 Ga0501269_000265 3300049766 Bacteria 14848
3277 Ga0501035_0000337 3300049822 Bacteria 54675
3278 Ga0501035_0000958 3300049822 Bacteria 30505
3279 Ga0501035_0002533 3300049822 Bacteria 17861
3280 Ga0501035_0004288 3300049822 Bacteria 13541
3281 Ga0501035_0005215 3300049822 Bacteria 12298
3282 Ga0501035_0007612 3300049822 Bacteria 10118
3283 Ga0501035_0011367 3300049822 Bacteria 8251
3284 Ga0501035_0015793 3300049822 Bacteria 6969
3285 Ga0501035_0023398 3300049822 Bacteria 5667
3286 Ga0501035_0024099 3300049822 Bacteria 5583
3287 Ga0501035_0112007 3300049822 Bacteria 2391
3288 Ga0501044_0000391 3300049823 Bacteria 54344
3289 Ga0501044_0000512 3300049823 Bacteria 47131
3290 Ga0501044_0000709 3300049823 Bacteria 40239
3291 Ga0501044_0001006 3300049823 Bacteria 33924
3292 Ga0501044_0001081 3300049823 Bacteria 32566
3293 Ga0501044_0001176 3300049823 Bacteria 30996
3294 Ga0501044_0004261 3300049823 Bacteria 16048
3295 Ga0501044_0004798 3300049823 Bacteria 15118
3296 Ga0501044_0004941 3300049823 Bacteria 14911
3297 Ga0501044_0007114 3300049823 Bacteria 12306
3298 Ga0501044_0009074 3300049823 Bacteria 10870
3299 Ga0501044_0011454 3300049823 Bacteria 9607
3300 Ga0501044_0015931 3300049823 Bacteria 8089
3301 Ga0501044_0017323 3300049823 Bacteria 7726
3302 Ga0501044_0024739 3300049823 Bacteria 6370
3303 Ga0501044_0033712 3300049823 Bacteria 5377
3304 Ga0501044_0034562 3300049823 Bacteria 5299
3305 Ga0501044_0042791 3300049823 Bacteria 4709
3306 Ga0501044_0059487 3300049823 Bacteria 3914
3307 Ga0501044_0061225 3300049823 Bacteria 3851
3308 Ga0501045_0043871 3300049824 Bacteria 3257
3309 Ga0501045_0053339 3300049824 Bacteria 2954
3310 Ga0501045_0055991 3300049824 Bacteria 2884
3311 Ga0501226_000004 3300049853 Bacteria 284656
3312 nmdc:mga03683_15374_c1 3300050489 Bacteria 2855
3313 nmdc:mga03n38_11035_c1 3300050490 Bacteria 3351
3314 nmdc:mga03n38_9259_c1 3300050490 Bacteria 3573
3315 nmdc:mga00v17_1632_c1 3300050491 Bacteria 11722
3316 nmdc:mga00v17_22530_c1 3300050491 Bacteria 3635
3317 nmdc:mga00v17_4815_c1 3300050491 Bacteria 7065
3318 nmdc:mga00v17_7785_c1 3300050491 Bacteria 5741
3319 nmdc:mga0yw44_21709_c1 3300050492 Bacteria 3587
3320 nmdc:mga0yw44_23124_c1 3300050492 Bacteria 3497
3321 nmdc:mga0yw44_28992_c1 3300050492 Bacteria 3191
3322 nmdc:mga0k408_3020_c1 3300050493 Bacteria 8922
3323 nmdc:mga0k408_30680_c1 3300050493 Bacteria 3066
3324 nmdc:mga06z11_2376_c1 3300050494 Bacteria 7168
3325 nmdc:mga06z11_71_c1 3300050494 Bacteria 42338
3326 nmdc:mga04h51_2946_c1 3300050495 Bacteria 4095
3327 nmdc:mga04h51_43_c1 3300050495 Bacteria 42355
3328 nmdc:mga07m45_15850_c1 3300050496 Bacteria 4029
3329 nmdc:mga07m45_29663_c1 3300050496 Bacteria 3027
3330 nmdc:mga07m45_430_c1 3300050496 Bacteria 17393
3331 nmdc:mga07m45_7175_c1 3300050496 Bacteria 5678
3332 nmdc:mga07m45_8479_c1 3300050496 Bacteria 5288
3333 nmdc:mga05p37_10776_c1 3300050507 Bacteria 10852
3334 nmdc:mga05p37_12100_c1 3300050507 Bacteria 10300
3335 nmdc:mga05p37_20283_c1 3300050507 Bacteria 8044
3336 nmdc:mga05p37_20331_c1 3300050507 Bacteria 8032
3337 nmdc:mga05p37_554_c1 3300050507 Bacteria 41106
3338 nmdc:mga05p37_58071_c1 3300050507 Bacteria 4765
3339 nmdc:mga05p37_58658_c1 3300050507 Bacteria 4741
3340 nmdc:mga05p37_7707_c2 3300050507 Bacteria 4310
3341 nmdc:mga05p37_86754_c1 3300050507 Bacteria 3858
3342 nmdc:mga09592_22742_c1 3300050508 Bacteria 5173
3343 nmdc:mga09592_3235_c1 3300050508 Bacteria 13181
3344 nmdc:mga0qj67_11041_c1 3300050509 Bacteria 6762
3345 nmdc:mga0qj67_12710_c1 3300050509 Bacteria 6350
3346 nmdc:mga0qj67_18005_c1 3300050509 Bacteria 5380
3347 nmdc:mga0qj67_25004_c1 3300050509 Bacteria 4609
3348 nmdc:mga0qj67_42190_c1 3300050509 Bacteria 3591
3349 nmdc:mga0qj67_4538_c1 3300050509 Bacteria 10060
3350 nmdc:mga0qj67_54504_c1 3300050509 Bacteria 3167
3351 nmdc:mga06r32_1170_c1 3300050510 Bacteria 23640
3352 nmdc:mga06r32_12640_c1 3300050510 Bacteria 7628
3353 nmdc:mga06r32_18698_c1 3300050510 Bacteria 6349
3354 nmdc:mga06r32_2159_c1 3300050510 Bacteria 17603
3355 nmdc:mga06r32_34493_c1 3300050510 Bacteria 4772
3356 nmdc:mga06r32_3851_c1 3300050510 Bacteria 13429
3357 nmdc:mga06r32_3933_c1 3300050510 Bacteria 13328
3358 nmdc:mga06r32_4999_c1 3300050510 Bacteria 11936
3359 nmdc:mga06r32_7572_c1 3300050510 Bacteria 9761
3360 nmdc:mga06r32_94114_c1 3300050510 Bacteria 2932
3361 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
3362 nmdc:mga08y16_2174_c1 3300050511 Bacteria 20101
3363 nmdc:mga08y16_34732_c1 3300050511 Bacteria 5298
3364 nmdc:mga08y16_36950_c1 3300050511 Bacteria 5129
3365 nmdc:mga08y16_46825_c1 3300050511 Bacteria 4527
3366 nmdc:mga08y16_4751_c1 3300050511 Bacteria 14163
3367 nmdc:mga08y16_52439_c1 3300050511 Bacteria 4268
3368 nmdc:mga08y16_85071_c1 3300050511 Bacteria 3296
3369 nmdc:mga0n895_125058_c1 3300050512 Bacteria 2595
3370 nmdc:mga0n895_14608_c1 3300050512 Bacteria 7139
3371 nmdc:mga0n895_62383_c1 3300050512 Bacteria 3684
3372 nmdc:mga0n895_71712_c1 3300050512 Bacteria 3435
3373 nmdc:mga0n895_83033_c1 3300050512 Bacteria 3195
3374 nmdc:mga0rr50_3091_c1 3300050513 Bacteria 9532
3375 nmdc:mga0rr50_9439_c1 3300050513 Bacteria 6133
3376 nmdc:mga0rr50_9522_c1 3300050513 Bacteria 6113
3377 nmdc:mga08x19_28115_c1 3300050514 Bacteria 3520
3378 nmdc:mga08x19_31257_c1 3300050514 Bacteria 3349
3379 nmdc:mga08x19_5112_c1 3300050514 Bacteria 7756
3380 nmdc:mga08x19_5799_c1 3300050514 Bacteria 7300
3381 nmdc:mga0a205_134234_c1 3300050515 Bacteria 2376
3382 nmdc:mga0a205_15133_c1 3300050515 Bacteria 7206
3383 nmdc:mga0a205_16070_c1 3300050515 Bacteria 7006
3384 nmdc:mga0a205_44381_c1 3300050515 Bacteria 4284
3385 nmdc:mga0a205_56383_c1 3300050515 Bacteria 3793
3386 Ga0495601_0001520 3300053077 Bacteria 12802
3387 Ga0495612_0013795 3300053078 Bacteria 3255
3388 Ga0500610_0020960 3300053079 Bacteria 3200
3389 Ga0500635_0000144 3300053080 Bacteria 40631
3390 Ga0500635_0005401 3300053080 Bacteria 3350
3391 Ga0495595_0002514 3300053084 Bacteria 7193
3392 Ga0495619_0007842 3300053085 Bacteria 6755
3393 Ga0495619_0010092 3300053085 Bacteria 5947
3394 Ga0495619_0060788 3300053085 Bacteria 2512
3395 Ga0500578_0016233 3300053086 Bacteria 4781
3396 Ga0500643_000003 3300053087 Bacteria 876659
3397 Ga0500643_002413 3300053087 Bacteria 9687
3398 Ga0500643_004785 3300053087 Bacteria 5991
3399 Ga0500643_005928 3300053087 Bacteria 5184
3400 Ga0500644_0000617 3300053088 Bacteria 13341
3401 Ga0500646_0002627 3300053090 Bacteria 4652
3402 Ga0500651_0001334 3300053093 Bacteria 12327
3403 Ga0500566_0000054 3300053094 Bacteria 54975
3404 Ga0500650_0006939 3300053098 Bacteria 4368
3405 Ga0500556_0000464 3300053104 Bacteria 28558
3406 Ga0500556_0002564 3300053104 Bacteria 5736
3407 Ga0500562_000982 3300053108 Bacteria 6975
3408 Ga0500572_001396 3300053111 Bacteria 6645
3409 Ga0500593_000113 3300053117 Bacteria 31265
3410 Ga0500595_000001 3300053119 Bacteria 1088438
3411 Ga0500597_004998 3300053120 Bacteria 4206
3412 Ga0500608_000335 3300053122 Bacteria 18148
3413 Ga0500618_000208 3300053125 Bacteria 46564
3414 Ga0500618_002267 3300053125 Bacteria 7473
3415 Ga0500652_000043 3300053131 Bacteria 64726
3416 Ga0500652_001403 3300053131 Bacteria 7504
3417 Ga0500652_002919 3300053131 Bacteria 5157
3418 Ga0500659_0000299 3300053135 Bacteria 31126
3419 Ga0500559_0011613 3300053136 Bacteria 3761
3420 Ga0500559_0016502 3300053136 Bacteria 3119
3421 Ga0500568_0002023 3300053139 Bacteria 12358
3422 Ga0500568_0004635 3300053139 Bacteria 7312
3423 Ga0500568_0004934 3300053139 Bacteria 7016
3424 Ga0500586_001061 3300053145 Bacteria 5670
3425 Ga0500588_0000024 3300053146 Bacteria 36113
3426 Ga0500604_0001644 3300053151 Bacteria 6284
3427 Ga0500616_0000022 3300053153 Bacteria 460463
3428 Ga0500616_0000086 3300053153 Bacteria 192348
3429 Ga0500616_0000107 3300053153 Bacteria 153426
3430 Ga0500616_0000134 3300053153 Bacteria 129376
3431 Ga0500616_0000251 3300053153 Bacteria 83237
3432 Ga0500616_0000966 3300053153 Bacteria 31132
3433 Ga0500616_0003662 3300053153 Bacteria 11527
3434 Ga0500616_0003760 3300053153 Bacteria 11300
3435 Ga0500616_0004640 3300053153 Bacteria 9698
3436 Ga0500616_0012767 3300053153 Bacteria 4904
3437 Ga0500616_0019485 3300053153 Bacteria 3823
3438 Ga0500622_0000099 3300053156 Bacteria 86951
3439 Ga0500622_0000921 3300053156 Bacteria 24968
3440 Ga0500622_0002504 3300053156 Bacteria 13205
3441 Ga0500634_0000075 3300053161 Bacteria 38614
3442 Ga0500639_006934 3300053163 Bacteria 5871
3443 Ga0500645_001842 3300053730 Bacteria 10159
3444 Ga0500645_003213 3300053730 Bacteria 6769
3445 Ga0501084_0012694 3300054114 Bacteria 6980
3446 Ga0501084_0022118 3300054114 Bacteria 5304
3447 Ga0501084_0022822 3300054114 Bacteria 5221
3448 Ga0501084_0050434 3300054114 Bacteria 3484
3449 Ga0587083_0001695 3300059505 Bacteria 2553
3450 Ga0501082_0000591 3300060353 Bacteria 32096
3451 Ga0501082_0001915 3300060353 Bacteria 18290
3452 Ga0501082_0007904 3300060353 Bacteria 9185
3453 Ga0501082_0008454 3300060353 Bacteria 8877
3454 Ga0501082_0016400 3300060353 Bacteria 6377
3455 Ga0501082_0017932 3300060353 Bacteria 6097
3456 Ga0501082_0024787 3300060353 Bacteria 5170
3457 Ga0501082_0032072 3300060353 Bacteria 4532
3458 Ga0466962_0000777 3300061719 Bacteria 14339
3459 Ga0466962_0002135 3300061719 Bacteria 9343
3460 Ga0466962_0002886 3300061719 Bacteria 8199
3461 Ga0466962_0004954 3300061719 Bacteria 6404
3462 Ga0466962_0006958 3300061719 Bacteria 5422
3463 Ga0466962_0007174 3300061719 Bacteria 5336
3464 Ga0466962_0009005 3300061719 Bacteria 4780
3465 Ga0466962_0014019 3300061719 Bacteria 3860
3466 Ga0466962_0014139 3300061719 Bacteria 3845
3467 Ga0530510_0004801 3300061734 Bacteria 9358
3468 Ga0530510_0023103 3300061734 Bacteria 4429
3469 Ga0530510_0027753 3300061734 Bacteria 4056
3470 Ga0530510_0027964 3300061734 Bacteria 4042
3471 2688391182 2687453341 Bacteria 6534136
3472 2501408791 2501025504 Bacteria 8008976
3473 2506868021 2506783011 Bacteria 5323186
3474 2508735307 2508501050 Bacteria 9633614
3475 2509141189 2508501127 Bacteria 7037543
3476 2509373582 2509276018 Bacteria 6910194
3477 2510135950 2510065019 Bacteria 6903379
3478 2510314003 2510065059 Bacteria 6847884
3479 2511098504 2510917014 Bacteria 8296963
3480 2511132780 2510917022 Bacteria 6504556
3481 2511173108 2510917026 Bacteria 7046020
3482 2511199771 2510917030 Bacteria 7460662
3483 2511244903 2511231002 Bacteria 5042903
3484 2511263899 2511231006 Bacteria 6794709
3485 2511270331 2511231007 Bacteria 6306603
3486 2511291270 2511231010 Bacteria 6373152
3487 2511296531 2511231011 Bacteria 6149768
3488 2511316548 2511231014 Bacteria 6462302
3489 2511367934 2511231023 Bacteria 6808468
3490 2511377306 2511231024 Bacteria 5835885
3491 2511414453 2511231031 Bacteria 6558529
3492 2512325096 2512047018 Bacteria 6663241
3493 2512531293 2512047086 Bacteria 6850303
3494 2512644987 2512564014 Bacteria 4639632
3495 2512929094 2512875016 Bacteria 6529530
3496 2513631178 2513237093 Bacteria 7545552
3497 2513910524 2513237144 Bacteria 7530820
3498 2513924079 2513237146 Bacteria 7166346
3499 2513998976 2513237159 Bacteria 6810126
3500 2515686530 2515154122 Bacteria 8609520
3501 2515856853 2515154155 Bacteria 7985436
3502 2516207066 2516143018 Bacteria 6951533
3503 2517098014 2517093000 Bacteria 7412387
3504 2517763598 2517572101 Bacteria 6884336
3505 2519462082 2519103095 Bacteria 6629912
3506 2521557174 2521172590 Bacteria 5047645
3507 2522552883 2522125168 Bacteria 7376607
3508 2523386283 2523231044 Bacteria 6434991
3509 2523470626 2523231067 Bacteria 5230452
3510 2524462007 2524023209 Bacteria 6679728
3511 2525557747 2524614729 Bacteria 3091755
3512 2528206775 2527291627 Bacteria 5309833
3513 2528215531 2527291629 Bacteria 5267418
3514 2546950733 2546825537 Bacteria 5389291
3515 2547375571 2547132103 Bacteria 5115736
3516 2547412577 2547132111 Bacteria 8013147
3517 2548500897 2547132374 Bacteria 5530232
3518 2548695915 2547132424 Bacteria 8348532
3519 2555230129 2554235227 Bacteria 3637389
3520 2555669696 2554235341 Bacteria 6867980
3521 2558905841 2558860112 Bacteria 9931328
3522 2558912712 2558860112 Bacteria 9931328
3523 2559432977 2558860280 Bacteria 11429938
3524 2563056186 2562617112 Bacteria 10918404
3525 2566035028 2565956521 Bacteria 4468993
3526 2566991490 2565956761 Bacteria 6601618
3527 2572253488 2571042365 Bacteria 3289345
3528 2579750620 2576861822 Bacteria 5004595
3529 2583150239 2582580736 Bacteria 5325865
3530 2583153447 2582580736 Bacteria 5325865
3531 2583791351 2582580891 Bacteria 6800976
3532 2585165058 2582581283 Bacteria 6030556
3533 2585204524 2582581294 Bacteria 6626667
3534 2585221503 2582581298 Bacteria 7315509
3535 2585270417 2582581306 Bacteria 6450535
3536 2585272507 2582581307 Bacteria 6597605
3537 2585278307 2582581308 Bacteria 7413247
3538 2585290958 2582581311 Bacteria 6763856
3539 2585299496 2582581312 Bacteria 7308206
3540 2585307426 2582581313 Bacteria 10042643
3541 2585324851 2582581315 Bacteria 7318924
3542 2585332331 2582581316 Bacteria 7774528
3543 2585387749 2582581865 Bacteria 6644329
3544 2585391824 2582581866 Bacteria 6859583
3545 2585532036 2585427527 Bacteria 7273426
3546 2585544327 2585427529 Bacteria 7395659
3547 2585552396 2585427530 Bacteria 7383882
3548 2585561429 2585427531 Bacteria 6992870
3549 2585901950 2585427608 Bacteria 6544331
3550 2585906658 2585427609 Bacteria 6667127
3551 2585992755 2585427633 Bacteria 6413184
3552 2586003465 2585427634 Bacteria 6455027
3553 2586060823 2585427649 Bacteria 9053857
3554 2587982079 2585428125 Bacteria 6662905
3555 2588514632 2588253730 Bacteria 6881675
3556 2595450271 2593339239 Bacteria 4124669
3557 2596374444 2595698237 Bacteria 6712432
3558 2596374837 2595698237 Bacteria 6712432
3559 2597811112 2597489875 Bacteria 7010078
3560 2599335238 2599185156 Bacteria 5403036
3561 2599353302 2599185160 Bacteria 6844013
3562 2599363699 2599185161 Bacteria 6960462
3563 2599370019 2599185162 Bacteria 6957254
3564 2599372326 2599185163 Bacteria 6995158
3565 2599378410 2599185164 Bacteria 6841688
3566 2599384213 2599185165 Bacteria 6843250
3567 2599391185 2599185166 Bacteria 6959206
3568 2599407430 2599185168 Bacteria 6997636
3569 2599416124 2599185170 Bacteria 7295545
3570 2599460136 2599185181 Bacteria 6844519
3571 2599489157 2599185186 Bacteria 6831633
3572 2599720766 2599185236 Bacteria 6875203
3573 2600192797 2599185352 Bacteria 7228948
3574 2600212745 2599185356 Bacteria 6843884
3575 2600227621 2599185359 Bacteria 4772316
3576 2600373400 2600254933 Bacteria 4750527
3577 2601772913 2600255313 Bacteria 6842543
3578 2601796135 2600255318 Bacteria 6383414
3579 2606075012 2603880185 Bacteria 6379190
3580 2606127875 2603880199 Bacteria 6377649
3581 2616307825 2615840626 Bacteria 7921970
3582 2616555178 2615840698 Bacteria 7319877
3583 2616692956 2616644814 Bacteria 11555299
3584 2617381850 2617270742 Bacteria 6808054
3585 2623589860 2622736626 Bacteria 7181580
3586 2624480181 2623620443 Bacteria 6427864
3587 2624491325 2623620446 Bacteria 6500345
3588 2630649339 2627854209 Bacteria 3093011
3589 2643746287 2643221544 Bacteria 5886209
3590 2643760656 2643221548 Bacteria 8053412
3591 2643790959 2643221554 Bacteria 6603920
3592 2643804514 2643221557 Bacteria 7184309
3593 2643815383 2643221559 Bacteria 4424915
3594 2643826963 2643221561 Bacteria 4984412
3595 2643849995 2643221567 Bacteria 4163945
3596 2643879430 2643221573 Bacteria 4784121
3597 2643888499 2643221575 Bacteria 4022601
3598 2643893016 2643221576 Bacteria 5214352
3599 2643905007 2643221578 Bacteria 9213798
3600 2643934837 2643221585 Bacteria 5812563
3601 2643940060 2643221586 Bacteria 4446529
3602 2643961925 2643221590 Bacteria 5214697
3603 2643974332 2643221593 Bacteria 6296053
3604 2643987989 2643221595 Bacteria 6565519
3605 2644005401 2643221599 Bacteria 6292121
3606 2644016216 2643221601 Bacteria 7493239
3607 2644034213 2643221604 Bacteria 5014917
3608 2644047541 2643221607 Bacteria 6314006
3609 2644062806 2643221609 Bacteria 6756331
3610 2644065527 2643221610 Bacteria 7480339
3611 2644077116 2643221612 Bacteria 4361984
3612 2644132546 2643221623 Bacteria 5239945
3613 2644135997 2643221624 Bacteria 4384879
3614 2644158159 2643221627 Bacteria 6761570
3615 2644159321 2643221628 Bacteria 5745828
3616 2644166917 2643221629 Bacteria 5850260
3617 2644205989 2643221636 Bacteria 6583769
3618 2644210671 2643221637 Bacteria 5345260
3619 2644214885 2643221638 Bacteria 6579467
3620 2644220606 2643221639 Bacteria 6649903
3621 2644264965 2643221647 Bacteria 10741251
3622 2644316324 2643221656 Bacteria 5809961
3623 2644349431 2643221662 Bacteria 5851492
3624 2644375483 2643221668 Bacteria 7306521
3625 2644403066 2643221673 Bacteria 9196637
3626 2644417129 2643221675 Bacteria 7473456
3627 2644444188 2643221679 Bacteria 3839507
3628 2644448119 2643221680 Bacteria 7473610
3629 2644457092 2643221681 Bacteria 3707866
3630 2644481008 2643221686 Bacteria 6310811
3631 2644485578 2643221687 Bacteria 6500351
3632 2644496683 2643221689 Bacteria 6042950
3633 2644512081 2643221692 Bacteria 7282860
3634 2644534310 2643221696 Bacteria 5431823
3635 2644538450 2643221697 Bacteria 3575694
3636 2644607355 2643221711 Bacteria 4865335
3637 2644637844 2643221715 Bacteria 6671032
3638 2644647692 2643221717 Bacteria 5676132
3639 2644654205 2643221718 Bacteria 5345506
3640 2644660727 2643221720 Bacteria 4694283
3641 2644677666 2643221723 Bacteria 7095460
3642 2644686728 2643221726 Bacteria 7455827
3643 2644695430 2643221727 Bacteria 4415595
3644 2644698087 2643221728 Bacteria 4797149
3645 2645720679 2643221961 Bacteria 3919167
3646 2645723698 2643221962 Bacteria 3874254
3647 2655031156 2654587600 Bacteria 3911798
3648 2671112849 2667528174 Bacteria 6435400
3649 2676483915 2675903059 Bacteria 8644972
3650 2676492611 2675903060 Bacteria 10051191
3651 2686543993 2684623036 Bacteria 5199090
3652 2688597638 2687453392 Bacteria 6880454
3653 2689993326 2687453743 Bacteria 8361025
3654 2691330261 2690315857 Bacteria 4396207
3655 2691330359 2690315857 Bacteria 4396207
3656 2692318627 2690316117 Bacteria 6800650
3657 2694628954 2693429783 Bacteria 7019804
3658 2694637131 2693429784 Bacteria 7241525
3659 2707101941 2706794495 Bacteria 4536932
3660 2710604720 2710264753 Bacteria 5455564
3661 2713481705 2711768613 Bacteria 11048459
3662 2715753510 2713897148 Bacteria 5883533
3663 2715758423 2713897149 Bacteria 6506249
3664 2718634536 2718217725 Bacteria 5758958
3665 2725947090 2724679232 Bacteria 7646494
3666 2729148048 2728369097 Bacteria 4333476
3667 2734968223 2734482000 Bacteria 5525167
3668 2738665407 2738541264 Bacteria 5935393
3669 2738688350 2738541271 Bacteria 5657310
3670 2738699031 2738541273 Bacteria 4048577
3671 2738710006 2738541275 Bacteria 4830863
3672 2738722058 2738541277 Bacteria 7458140
3673 2738746413 2738541281 Bacteria 5112672
3674 2738826357 2738541297 Bacteria 6549566
3675 2738848431 2738541301 Bacteria 4834102
3676 2738850420 2738541301 Bacteria 4834102
3677 2738864160 2738541304 Bacteria 4833665
3678 2738866149 2738541304 Bacteria 4833665
3679 2738881148 2738541307 Bacteria 8606193
3680 2738891248 2738541308 Bacteria 7020677
3681 2739144541 2738541356 Bacteria 5935017
3682 2739150154 2738541357 Bacteria 6549408
3683 2739192073 2738543003 Bacteria 6549560
3684 2739254747 2738543014 Bacteria 4048139
3685 2739264082 2738543016 Bacteria 5657564
3686 2739282422 2738543019 Bacteria 7459457
3687 2739296678 2738543022 Bacteria 4835059
3688 2739298667 2738543022 Bacteria 4835059
3689 2739309564 2738543024 Bacteria 5603683
3690 2739313172 2738543025 Bacteria 6600348
3691 2739318550 2738543026 Bacteria 6549408
3692 2739336791 2738543029 Bacteria 6549249
3693 2739355643 2738543032 Bacteria 5115625
3694 2739358356 2738543033 Bacteria 4833336
3695 2739360345 2738543033 Bacteria 4833336
3696 2740165474 2739367898 Bacteria 4367674
3697 2743738657 2740892503 Bacteria 6855563
3698 2746090175 2744054900 Bacteria 8399525
3699 2746095615 2744054901 Bacteria 8397047
3700 2748017221 2747842501 Bacteria 5293829
3701 2753264521 2751185782 Bacteria 11227053
3702 2753458085 2751185821 Bacteria 6189929
3703 2756671923 2756170246 Bacteria 7451806
3704 2765568301 2765235838 Bacteria 5445269
3705 2765583291 2765235841 Bacteria 6137024
3706 2770199545 2767802442 Bacteria 5747986
3707 2774137993 2773857673 Bacteria 6513460
3708 2774866674 2773857924 Bacteria 5256821
3709 2774872249 2773857925 Bacteria 6472445
3710 2774904389 2773857933 Bacteria 5818019
3711 2778178321 2775507266 Bacteria 7392367
3712 2784264933 2784132063 Bacteria 6262788
3713 2784592518 2784132148 Bacteria 8627943
3714 2785339346 2784746763 Bacteria 9783172
3715 2785372131 2784746768 Bacteria 10036182
3716 2786673218 2786546132 Bacteria 10419719
3717 2792619574 2791355091 Bacteria 6135441
3718 2792627346 2791355092 Bacteria 6248105
3719 2792639759 2791355094 Bacteria 7011481
3720 2792752118 2791355123 Bacteria 8049106
3721 2793980354 2791355406 Bacteria 11364898
3722 2793981964 2791355406 Bacteria 11364898
3723 2795786098 2795385470 Bacteria 8317180
3724 2795796877 2795385472 Bacteria 6627535
3725 2807407941 2806310737 Bacteria 5751088
3726 2807456244 2806310745 Bacteria 5742165
3727 2808874051 2808606365 Bacteria 4301966
3728 2808914153 2808606375 Bacteria 9466072
3729 2808930198 2808606377 Bacteria 6646337
3730 2808952237 2808606381 Bacteria 6646461
3731 2808984924 2808606386 Bacteria 4471946
3732 2809131812 2808606415 Bacteria 4576710
3733 2809151376 2808606419 Bacteria 4576925
3734 2809236147 2808606448 Bacteria 8656184
3735 2809590183 2808606522 Bacteria 9488490
3736 2812369071 2811994881 Bacteria 6298475
3737 2812477024 2811994917 Bacteria 7761064
3738 2817258198 2816332253 Bacteria 6764532
3739 2817281388 2816332256 Bacteria 6891714
3740 2817451938 2816332286 Bacteria 6853759
3741 2819426512 2818991318 Bacteria 5266538
3742 2819607953 2818991448 Bacteria 6772224
3743 2819618669 2818991449 Bacteria 5518009
3744 2819640281 2818991453 Bacteria 7181617
3745 2819656849 2818991456 Bacteria 6123676
3746 2819665522 2818991458 Bacteria 4794049
3747 2819705516 2818991464 Bacteria 6907494
3748 2819715059 2818991466 Bacteria 4748179
3749 2819746570 2818991472 Bacteria 10089953
3750 2821124431 2821123053 Bacteria 7836056
3751 2821450611 2821443989 Bacteria 7658172
3752 2829746121 2829745981 Bacteria 5406054
3753 2830077595 2830075706 Bacteria 3855215
3754 2831867815 2831864461 Bacteria 6502356
3755 2837652113 2837651117 Bacteria 3772164
3756 2838032790 2838029111 Bacteria 6603031
3757 2838036246 2838035591 Bacteria 7166484
3758 2838076019 2838074704 Bacteria 6785777
3759 2838666523 2838661181 Bacteria 7385261
3760 2838741076 2838736955 Bacteria 5760694
3761 2839094839 2839094727 Bacteria 5534556
3762 2840768777 2840764183 Bacteria 6358399
3763 2841735579 2841734538 Bacteria 6784580
3764 2841845027 2841840854 Bacteria 5761912
3765 2842144749 2842140634 Bacteria 5759631
3766 2842303323 2842298080 Bacteria 6123127
3767 2842362046 2842357229 Bacteria 6485165
3768 2842479522 2842475841 Bacteria 6603183
3769 2842486934 2842482326 Bacteria 7212537
3770 2842506812 2842502639 Bacteria 6604161
3771 2842514983 2842509118 Bacteria 6850950
3772 2842515173 2842509118 Bacteria 6850950
3773 2842524717 2842521101 Bacteria 6569494
3774 2842697146 2842694124 Bacteria 4063419
3775 2842699043 2842698319 Bacteria 5190321
3776 2842759410 2842757796 Bacteria 3981385
3777 2842835316 2842832357 Bacteria 5959113
3778 2842844135 2842843487 Bacteria 6004777
3779 2842915533 2842914999 Bacteria 4419378
3780 2842920616 2842918807 Bacteria 4289178
3781 2842927138 2842922631 Bacteria 5824079
3782 2843695685 2843690924 Bacteria 5169057
3783 2844008133 2844002411 Bacteria 7168230
3784 2844013026 2844009547 Bacteria 6728125
3785 2844539659 2844533157 Bacteria 7517899
3786 2844849914 2844849076 Bacteria 4091819
3787 2846035388 2846033681 Bacteria 4377894
3788 2846038920 2846037992 Bacteria 4526407
3789 2847422873 2847417321 Bacteria 6913799
3790 2847672560 2847670302 Bacteria 6165597
3791 2848695136 2848694841 Bacteria 9205737
3792 2848997724 2848992105 Bacteria 6810864
3793 2852393557 2852387548 Bacteria 8025568
3794 2852620856 2852618963 Bacteria 4577824
3795 2852623756 2852623160 Bacteria 4376875
3796 2852662142 2852657418 Bacteria 6472974
3797 2852689185 2852684882 Bacteria 5463342
3798 2855872628 2855872281 Bacteria 6964271
3799 2856315788 2856314179 Bacteria 6477897
3800 2856333536 2856328259 Bacteria 6528202
3801 2856337941 2856334872 Bacteria 7037011
3802 2856343859 2856342000 Bacteria 7176905
3803 2856355380 2856349417 Bacteria 6230045
3804 2856744560 2856741275 Bacteria 8096094
3805 2857368954 2857367948 Bacteria 6965560
3806 2857481908 2857481737 Bacteria 4761446
3807 2857486103 2857481737 Bacteria 4761446
3808 2857532011 2857531043 Bacteria 6754041
3809 2858689534 2858688981 Bacteria 8184122
3810 2862281594 2862281513 Bacteria 9621493
3811 2862284092 2862281513 Bacteria 9621493
3812 2862389898 2862382967 Bacteria 10317375
3813 2863410611 2863404153 Bacteria 9672205
3814 2863411053 2863404153 Bacteria 9672205
3815 2866615240 2866612099 Bacteria 7543886
3816 2867306672 2867302475 Bacteria 7087181
3817 2867317437 2867312974 Bacteria 7058875
3818 2867325145 2867319477 Bacteria 7069771
3819 2867370823 2867369537 Bacteria 6501581
3820 2867432112 2867428634 Bacteria 9590268
3821 2867475435 2867475112 Bacteria 6909112
3822 2868091048 2868088558 Bacteria 7609351
3823 2869163871 2869162929 Bacteria 6399702
3824 2869171315 2869169390 Bacteria 6659796
3825 2869236764 2869234852 Bacteria 6654993
3826 2869243458 2869242130 Bacteria 6609239
3827 2869251109 2869249662 Bacteria 6868783
3828 2869261635 2869256925 Bacteria 6981691
3829 2869270551 2869264136 Bacteria 6880765
3830 2869277963 2869271264 Bacteria 6908218
3831 2870783685 2870782633 Bacteria 9624083
3832 2871459549 2871451962 Bacteria 7336357
3833 2871468303 2871466892 Bacteria 6923287
3834 2871482686 2871481445 Bacteria 6700002
3835 2873316820 2873314349 Bacteria 8512634
3836 2874112020 2874109183 Bacteria 6517025
3837 2874118176 2874116593 Bacteria 6674494
3838 2874126860 2874123672 Bacteria 7238285
3839 2874139080 2874131515 Bacteria 6820270
3840 2874165362 2874162495 Bacteria 6174670
3841 2875392423 2875391855 Bacteria 7600475
3842 2876369560 2876363079 Bacteria 6544991
3843 2876374855 2876369609 Bacteria 6807521
3844 2876386397 2876386047 Bacteria 6698674
3845 2876402898 2876399893 Bacteria 6927900
3846 2876408753 2876406927 Bacteria 6191900
3847 2876426679 2876420981 Bacteria 6687741
3848 2877678496 2877676314 Bacteria 9512378
3849 2878032091 2878029506 Bacteria 6418441
3850 2878042402 2878035449 Bacteria 6555736
3851 2878777576 2878774303 Bacteria 6108671
3852 2878784403 2878781027 Bacteria 6834456
3853 2878795734 2878788777 Bacteria 6567085
3854 2879164082 2879163058 Bacteria 4223965
3855 2880233026 2880230671 Bacteria 6140320
3856 2881103836 2881101125 Bacteria 4590519
3857 2881154587 2881147464 Bacteria 7779814
3858 2881158354 2881155292 Bacteria 6461656
3859 2881857405 2881853255 Bacteria 6698367
3860 2882634251 2882632389 Bacteria 8154593
3861 2883095962 2883087390 Bacteria 9532701
3862 2883825358 2883821847 Bacteria 5121194
3863 2884411998 2884411467 Bacteria 5246714
3864 2884937337 2884933994 Bacteria 4535041
3865 2885318755 2885312484 Bacteria 6415165
3866 2885345191 2885342637 Bacteria 7011821
3867 2885358009 2885350715 Bacteria 6787678
3868 2885384202 2885383462 Bacteria 9473874
3869 2886631199 2886627955 Bacteria 7618130
3870 2886854132 2886848708 Bacteria 5632523
3871 2887484068 2887478801 Bacteria 8972725
3872 2887631427 2887630918 Bacteria 3239855
3873 2888346355 2888343758 Bacteria 6611049
3874 2889013725 2889010040 Bacteria 6749192
3875 2889021567 2889016732 Bacteria 6700763
3876 2889307461 2889306138 Bacteria 6358934
3877 2889419146 2889415604 Bacteria 8048700
3878 2891329380 2891326441 Bacteria 6439512
3879 2891376023 2891373044 Bacteria 5202277
3880 2891402076 2891395885 Bacteria 9251614
3881 2891561247 2891554331 Bacteria 8812224
3882 2891565996 2891562705 Bacteria 8039471
3883 2891675061 2891670763 Bacteria 4967099
3884 2894511696 2894510363 Bacteria 5121143
3885 2894776267 2894772417 Bacteria 5305674
3886 2895436738 2895427314 Bacteria 13147766
3887 2896388399 2896384573 Bacteria 7700774
3888 2897564345 2897561785 Bacteria 3256946
3889 2899374008 2899370129 Bacteria 6781179
3890 2899375960 2899370129 Bacteria 6781179
3891 2900634762 2900634093 Bacteria 10263517
3892 2902690551 2902682994 Bacteria 8951596
3893 2902797419 2902792274 Bacteria 7270173
3894 2902816581 2902810491 Bacteria 6794147
3895 2902843377 2902837492 Bacteria 6697721
3896 2903453148 2903448605 Bacteria 7357801
3897 2903518756 2903513507 Bacteria 6344008
3898 2903526838 2903521522 Bacteria 6525694
3899 2903530171 2903528002 Bacteria 6586099
3900 2904433075 2904430863 Bacteria 3486923
3901 2904437872 2904434214 Bacteria 6230908
3902 2904440118 2904439833 Bacteria 5931679
3903 2904523412 2904518522 Bacteria 6068986
3904 2904530946 2904530477 Bacteria 5876334
3905 2904541015 2904535858 Bacteria 6308016
3906 2904587421 2904584206 Bacteria 6028872
3907 2904592544 2904589729 Bacteria 6113573
3908 2904604665 2904601388 Bacteria 5884906
3909 2904695528 2904690495 Bacteria 9412302
3910 2906364793 2906363423 Bacteria 6856682
3911 2906377213 2906370794 Bacteria 6881062
3912 2906389445 2906386501 Bacteria 5977019
3913 2906398415 2906393657 Bacteria 6790866
3914 2906402416 2906401398 Bacteria 6693206
3915 2906412519 2906408224 Bacteria 6162342
3916 2906415925 2906414383 Bacteria 6580790
3917 2906633442 2906626472 Bacteria 8826946
3918 2906799945 2906799679 Bacteria 4031749
3919 2911140803 2911138879 Bacteria 5811561
3920 2911141828 2911138879 Bacteria 5811561
3921 2912715991 2912715099 Bacteria 9460473
3922 2912727067 2912723979 Bacteria 8557534
3923 2912761124 2912757875 Bacteria 7940295
3924 2913298804 2913295892 Bacteria 6333755
3925 2915361759 2915358134 Bacteria 6050864
3926 2915769932 2915768154 Bacteria 8424322
3927 2916179021 2916178963 Bacteria 5265078
3928 2916973990 2916971899 Bacteria 4250608
3929 2917073515 2917070673 Bacteria 6868303
3930 2917741930 2917736166 Bacteria 9690793
3931 2917743739 2917736166 Bacteria 9690793
3932 2919038156 2919034639 Bacteria 4763403
3933 2919039710 2919039151 Bacteria 3391018
3934 2919050475 2919046199 Bacteria 5567169
3935 2919053574 2919051321 Bacteria 4210889
3936 2919068564 2919063839 Bacteria 6302690
3937 2919082495 2919079590 Bacteria 5946433
3938 2919085849 2919085039 Bacteria 4532964
3939 2919103591 2919100787 Bacteria 7710546
3940 2919130444 2919130084 Bacteria 5301837
3941 2919176099 2919171160 Bacteria 6499771
3942 2919386919 2919385768 Bacteria 5897293
3943 2919406818 2919404418 Bacteria 4232372
3944 2919412635 2919408235 Bacteria 6149349
3945 2919427950 2919425241 Bacteria 8055701
3946 2919449232 2919446982 Bacteria 3994487
3947 2919462214 2919456309 Bacteria 6586567
3948 2919478760 2919476304 Bacteria 5888696
3949 2919492927 2919487758 Bacteria 5929766
3950 2919516490 2919513703 Bacteria 3844312
3951 2919535424 2919534386 Bacteria 4577686
3952 2919678630 2919675420 Bacteria 3969095
3953 2919691414 2919688452 Bacteria 4595932
3954 2919697584 2919692658 Bacteria 5943958
3955 2919701165 2919697872 Bacteria 6553725
3956 2919705603 2919704043 Bacteria 5560311
3957 2920826884 2920822456 Bacteria 6897201
3958 2921646769 2921643360 Bacteria 11448031
3959 2921652285 2921643360 Bacteria 11448031
3960 2922152034 2922151315 Bacteria 6902399
3961 2922175855 2922172374 Bacteria 6167644
3962 2922560659 2922554459 Bacteria 6683962
3963 2923157722 2923153595 Bacteria 6870622
3964 2923523152 2923519811 Bacteria 6298479
3965 2924741143 2924741084 Bacteria 6661321
3966 2924752687 2924748358 Bacteria 6154725
3967 2928027564 2928027323 Bacteria 4382488
3968 2928030764 2928027323 Bacteria 4382488
3969 2928101705 2928100450 Bacteria 4837635
3970 2928103520 2928100450 Bacteria 4837635
3971 2928125547 2928125067 Bacteria 5937560
3972 2928133407 2928130867 Bacteria 5467269
3973 2928163479 2928157003 Bacteria 7522202
3974 2928167007 2928163908 Bacteria 7561269
3975 2928531075 2928526807 Bacteria 4760224
3976 2928531475 2928531327 Bacteria 5101314
3977 2928959795 2928959182 Bacteria 4725774
3978 2928962937 2928959182 Bacteria 4725774
3979 2928972251 2928968154 Bacteria 4633371
3980 2929186693 2929183550 Bacteria 6377511
3981 2929198549 2929195423 Bacteria 5325372
3982 2929200736 2929199973 Bacteria 7260745
3983 2935357475 2935353572 Unclassified 6955622
3984 2936344140 2936340661 Bacteria 5139038
3985 2937842390 2937836603 Bacteria 6811263
3986 2937851493 2937848649 Bacteria 6983481
3987 2937863387 2937861824 Bacteria 6660327
3988 2937868991 2937868953 Bacteria 6639878
3989 2939588680 2939582691 Bacteria 7088898
3990 2939651309 2939647034 Bacteria 4681660
3991 2941489533 2941489479 Bacteria 6313767
3992 2941490968 2941489479 Bacteria 6313767
3993 2945910284 2945909444 Bacteria 7065066
3994 2945917388 2945916053 Bacteria 4555517
3995 2945922390 2945920336 Bacteria 4501603
3996 2945962790 2945961074 Bacteria 7342064
3997 2945972574 2945972063 Bacteria 6086495
3998 2945987675 2945984333 Bacteria 7358892
3999 2946052388 2946045630 Bacteria 8527308
4000 2947232892 2947224130 Bacteria 9938529
4001 2952256077 2952252522 Bacteria 4171745
4002 2953995905 2953994433 Bacteria 4303959
4003 2954007476 2954002825 Bacteria 9173742
4004 2954383454 2954380949 Bacteria 10050426
4005 2954679518 2954673503 Bacteria 9685905
4006 2954684638 2954682443 Bacteria 9862841
4007 2954692045 2954691527 Bacteria 10720516
4008 2954694232 2954691527 Bacteria 10720516
4009 2954707112 2954701450 Bacteria 10834262
4010 2954709345 2954701450 Bacteria 10834262
4011 2954713765 2954711539 Bacteria 10867210
4012 2954723732 2954721474 Bacteria 10456478
4013 2954738104 2954731030 Bacteria 10243860
4014 2954742632 2954740390 Bacteria 10229294
4015 2954756962 2954749733 Bacteria 10366972
4016 2954761596 2954759201 Bacteria 9358192
4017 2958075426 2958071322 Bacteria 6815895
4018 2958103867 2958100919 Bacteria 6800575
4019 2958110095 2958108152 Bacteria 6681128
4020 2958124137 2958122699 Bacteria 7280457
4021 2958141672 2958137437 Bacteria 6050276
4022 2958173381 2958172287 Bacteria 6716688
4023 2961132986 2961127735 Bacteria 7196641
4024 2961187176 2961183825 Bacteria 6688536
4025 2963650140 2963644680 Bacteria 6530403
4026 2965025829 2965025482 Bacteria 6532201
4027 2965040581 2965040258 Bacteria 6855979
4028 2965094347 2965089291 Bacteria 6866420
4029 2965105126 2965102966 Bacteria 6800987
4030 2965122794 2965119406 Bacteria 6956431
4031 2965323670 2965320100 Bacteria 3975600
4032 2968086514 2968083720 Bacteria 7351627
4033 2968141572 2968138860 Bacteria 6605449
4034 2969307021 2969304461 Bacteria 6601805
4035 2970493423 2970489779 Bacteria 6517260
4036 2970511186 2970510686 Bacteria 7006402
4037 2970527862 2970524798 Bacteria 6840927
4038 2970536008 2970532167 Bacteria 6553173
4039 2970543158 2970540015 Bacteria 6977556
4040 2970551522 2970547951 Bacteria 6931819
4041 2970623283 2970619444 Bacteria 6986144
4042 2970627573 2970627176 Bacteria 6680862
4043 2974291567 2974289157 Bacteria 6080362
4044 2974305396 2974302888 Bacteria 4369871
4045 2977852190 2977851361 Bacteria 6694324
4046 2977868287 2977864932 Bacteria 7534097
4047 2977878034 2977872689 Bacteria 7270173
4048 2977909840 2977907340 Bacteria 6577984
4049 2977917884 2977915119 Bacteria 6829656
4050 2977923210 2977922695 Bacteria 6956781
4051 2977939068 2977935797 Bacteria 6252826
4052 2977954720 2977950692 Bacteria 6893264
4053 2977963826 2977957713 Bacteria 6877875
4054 2977992488 2977986579 Bacteria 6581278
4055 2979769113 2979764755 Bacteria 6610066
4056 2980182931 2980182181 Bacteria 9454109
4057 2981996710 2981990288 Bacteria 7590678
4058 2984556514 2984555340 Bacteria 4247089
4059 2984558143 2984555340 Bacteria 4247089
4060 2984565314 2984564862 Bacteria 4339992
4061 2984567489 2984564862 Bacteria 4339992
4062 2984594202 2984592036 Bacteria 3670284
4063 2987645653 2987645492 Bacteria 6117018
4064 2987655465 2987652177 Bacteria 6969023
4065 2990048764 2990044586 Bacteria 6603797
4066 2990061001 2990059506 Bacteria 9321252
4067 2990064426 2990059506 Bacteria 9321252
4068 2990089721 2990088156 Bacteria 6657676
4069 2990198240 2990196909 Bacteria 4054280
4070 2993356388 2993356040 Bacteria 4247105
4071 2993358543 2993356040 Bacteria 4247105
4072 2995726344 2995726249 Bacteria 3470435
4073 2995950029 2995948881 Bacteria 6358104
4074 2996388529 2996386984 Bacteria 6978667
4075 2997455568 2997451912 Bacteria 8492419
4076 2997605309 2997600082 Bacteria 9896405
4077 2998142213 2998139840 Bacteria 6073514
4078 2998346635 2998344455 Bacteria 4222996
4079 3001121477 3001119090 Bacteria 3449530
4080 3003000273 3002998708 Bacteria 11715108
4081 3003666444 3003665799 Bacteria 7279786
4082 3004168068 3004167301 Bacteria 8330599
4083 3004213500 3004211236 Bacteria 7417683
4084 3004221213 3004218560 Bacteria 7421728
4085 3004236343 3004232784 Bacteria 6662140
4086 3004244353 3004239961 Bacteria 6892290
4087 3004253998 3004248173 Bacteria 6563236
4088 3005421196 3005416602 Bacteria 7064308
4089 3005457628 3005452660 Bacteria 5889319
4090 3006399744 3006393351 Bacteria 6615579
4091 3006488829 3006486233 Bacteria 8157040
4092 3007619280 3007614139 Bacteria 6053559
4093 3007723363 3007718800 Bacteria 5971527
4094 3007806952 3007803356 Bacteria 5931491
4095 3007856425 3007855910 Bacteria 5637581
4096 3007862526 3007861166 Bacteria 6045338
4097 3007872207 3007872151 Bacteria 5268868
4098 637879256 637000116 Bacteria 5433628
4099 637078814 637000159 Bacteria 7596297
4100 637320029 637000220 Bacteria 7074893
4101 639788145 639633007 Bacteria 4376040
4102 640487582 640427133 Bacteria 4567418
4103 642418220 641736154 Bacteria 7689995
4104 643823114 643692032 Bacteria 6891900
4105 649872182 649633066 Bacteria 6690028
4106 651175527 651053060 Bacteria 4689946
4107 8001526165 8001522603 Bacteria 4726425
4108 8001787490 8001781756 Bacteria 9586736
4109 8002288242 8002285264 Bacteria 6717907
4110 8002790263 8002784119 Bacteria 9788632
4111 8002872654 8002869464 Bacteria 3588529
4112 8004306926 8004300914 Bacteria 6132239
4113 8004362786 8004361976 Bacteria 6858373
4114 8004636452 8004633249 Bacteria 6723080
4115 8004702412 8004695233 Bacteria 6731676
4116 8004728556 8004727605 Bacteria 6643904
4117 8005319069 8005314921 Bacteria 7072929
4118 8005489610 8005484373 Bacteria 6297373
4119 8005559321 8005556819 Bacteria 6908598
4120 8005565359 8005563573 Bacteria 7153261
4121 8005650471 8005645114 Bacteria 6950293
4122 8005684126 8005682033 Bacteria 6726518
4123 8006929814 8006926726 Bacteria 6749210
4124 8008486124 8008485437 Bacteria 7198341
4125 8008564640 8008558824 Bacteria 10610750
4126 8008575385 8008574985 Bacteria 7815457
4127 8011353693 8011350971 Bacteria 6158957
4128 8015559291 8015556637 Bacteria 3582323
4129 8018154278 8018150411 Bacteria 5549903
4130 8018165682 8018163183 Bacteria 7277977
4131 8019778233 8019775933 Bacteria 6858656
4132 8020813528 8020807995 Bacteria 6801506
4133 8023629231 8023623736 Bacteria 8593882
4134 8025525440 8025524527 Bacteria 7197316
4135 8025534226 8025530807 Bacteria 8495698
4136 8029998490 8029995093 Bacteria 5990776
4137 8036739285 8036736890 Bacteria 2944828
4138 8040167289 8040167225 Bacteria 6542727
4139 8040179087 8040173305 Bacteria 6827067
4140 8047715684 8047710418 Bacteria 11023148
4141 8047894611 8047893842 Bacteria 11723082
4142 8047902342 8047893842 Bacteria 11723082
4143 8048134939 8048127548 Bacteria 11053136
4144 8048364441 8048356638 Bacteria 11044339
4145 8048370138 8048369669 Bacteria 11666822
4146 8048371629 8048369669 Bacteria 11666822
4147 8048380562 8048379754 Bacteria 11877923
4148 8048390131 8048379754 Bacteria 11877923
4149 8048411283 8048406513 Bacteria 8936924
4150 8052497913 8052494512 Bacteria 5765634
4151 8053948389 8053945823 Bacteria 8962862
4152 8054304460 8054302542 Bacteria 5698134
4153 8054360236 8054357960 Bacteria 2867777
4154 8054477552 8054472261 Bacteria 7464355
4155 8054479083 8054472261 Bacteria 7464355
4156 8054931778 8054929484 Bacteria 5599761
4157 8055067990 8055066027 Bacteria 9479577
4158 8055175039 8055172936 Bacteria 9305943
4159 8055619154 8055617313 Bacteria 7548464
4160 8055775043 8055770955 Bacteria 6827675
4161 8055913953 8055909800 Bacteria 7278581
4162 8056061242 8056060235 Bacteria 7259403
4163 8056122867 8056120720 Bacteria 5758328
4164 8056139868 8056137416 Bacteria 6147080
4165 8056168856 8056166840 Bacteria 5820959
4166 8056173882 8056172158 Bacteria 6133900
4167 8056574252 8056569372 Bacteria 5997322
4168 8056694159 8056689827 Bacteria 6712655
4169 8056834704 8056829672 Bacteria 9045328
4170 8057102869 8057101203 Bacteria 5034064
4171 8057474809 8057473075 Bacteria 5892720
4172 8057571114 8057568493 Bacteria 7221719
4173 8057579750 8057575449 Bacteria 7367519
4174 8057634510 8057632132 Bacteria 4726859
4175 SwRhRL2b_contig_1758216
4176 SwRhRL2b_contig_2631586
4177 SwRhRL2b_contig_564562
4178 SwRhRL2b_contig_936608
4179 ARSoilOldRDRAFT_c000001
4180 LJNas_1000361
4181 LJNas_1001976
4182 JGI24746J21847_1000807
4183 JGI24740J21852_10000672
4184 JGI24740J21852_10002015
4185 JGI24740J21852_10005770
4186 JGI24740J21852_10015975
4187 JGI24739J22299_10006818
4188 JGI24737J22298_10000431
4189 JGI24735J21928_10001372
4190 JGI24738J21930_10000975
4191 JGI25155J39150_1000020
4192 JGI25155J39150_1000086
4193 JGI25156J39149_1000021
4194 JGI25156J39149_1000063
4195 JGI25156J39149_1000111
4196 JGI25156J39149_1001299
4197 JGI25162J39368_1000053
4198 JGI25162J39368_1000114
4199 JGI25162J39368_1000198
4200 JGI25162J39368_1000361
4201 JGI25162J39368_1001741
4202 JGI25154J39366_1000039
4203 JGI25154J39366_1000134
4204 JGI25154J39366_1000533
4205 JGI25158J39367_1000342
4206 JGI25157J39369_1000019
4207 JGI25157J39369_1000082
4208 JGI25157J39369_1000152
4209 JGI25157J39369_1000172
4210 JGI25163J39215_1000117
4211 JGI25163J39215_1000270
4212 JGI25164J39214_1000042
4213 JGI25164J39214_1000130
4214 JGI25164J39214_1000261
4215 JGI25152J39213_1000523
4216 JGI25152J39213_1000918
4217 JGI25152J39213_1004581
4218 JGI25150J39212_1000928
4219 JGI25159J45721_1000110
4220 JGI25159J45721_1000873
4221 JGI25159J45721_1001476
4222 JGI25159J45721_1001681
4223 JGI25159J45721_1001834
4224 JGI25151J46595_10000181
4225 JGI25151J46595_10000321
4226 JGI25151J46595_10001115
4227 JGI25151J46595_10006979
4228 JGI25151J46595_10009369
4229 JGI25406J46586_10001223
4230 JGI25406J46586_10002129
4231 JGI25406J46586_10007760
4232 JGI25165J46597_1000060
4233 JGI25165J46597_1000209
4234 JGI25165J46597_1000232
4235 JGI25165J46597_1000299
4236 JGI25165J46597_1001867
4237 JGI25165J46597_1003441
4238 JGI25153J46596_10013257
4239 rootH2_10000063
4240 JGI25160J50197_1000007
4241 JGI25160J50197_1002492
4242 JGI25407J50210_10000533
4243 JGI25161J50226_1000096
4244 JGI25161J50226_1000109
4245 JGI25161J50226_1000455
4246 JGI25161J50226_1000873
4247 Ga0006556J51387_1016523
4248 Ga0007417J51691_1038973
4249 Ga0007417J51691_1047384
4250 Ga0006554J51385_1012457
4251 Ga0006562J51391_1005712
4252 Ga0006562J51391_1012446
4253 Ga0006562J51391_1030291
4254 Ga0006562J51391_1040575
4255 Ga0006562J51391_1097156
4256 Ga0055538_1000013
4257 Ga0055539_1000018
4258 Ga0055539_1000602
4259 Ga0055539_1000767
4260 Ga0055533_1000022
4261 Ga0055533_1000043
4262 Ga0055525_1000024
4263 Ga0055525_1000031
4264 Ga0055525_1000192
4265 Ga0055525_1001195
4266 Ga0055527_1000041
4267 Ga0055527_1000466
4268 Ga0055535_1000079
4269 Ga0055535_1000193
4270 Ga0055535_1001154
4271 Ga0055535_1001333
4272 Ga0055542_1000152
4273 Ga0055542_1000183
4274 Ga0055542_1001024
4275 Ga0055542_1001148
4276 Ga0055529_1000464
4277 Ga0055529_1000511
4278 Ga0055529_1000934
4279 Ga0055526_1001612
4280 Ga0055526_1001820
4281 Ga0055526_1003708
4282 Ga0055526_1005773
4283 Ga0055537_1000086
4284 Ga0055537_1000368
4285 Ga0055524_1000093
4286 Ga0055524_1000157
4287 Ga0055524_1000194
4288 Ga0055524_1001239
4289 Ga0055524_1001675
4290 Ga0055524_1004780
4291 Ga0055524_1005098
4292 Ga0055524_1006153
4293 Ga0055536_1000015
4294 Ga0055536_1000090
4295 Ga0055536_1000115
4296 Ga0055536_1000214
4297 Ga0055536_1001307
4298 Ga0055536_1002997
4299 Ga0055536_1007825
4300 Ga0055536_1017564
4301 Ga0055534_1000110
4302 Ga0055534_1000938
4303 Ga0055534_1003609
4304 Ga0055534_1003859
4305 Ga0055528_1000131
4306 Ga0055528_1000151
4307 Ga0055528_1000961
4308 Ga0055530_10000541
4309 Ga0055530_10001776
4310 Ga0055530_10003231
4311 Ga0055530_10003923
4312 Ga0055530_10005511
4313 Ga0055530_10007421
4314 Ga0055540_1000024
4315 Ga0055540_1000089
4316 Ga0055540_1000204
4317 Ga0055540_1001962
4318 Ga0055540_1002979
4319 Ga0055540_1015122
4320 Ga0055531_10000186
4321 Ga0055531_10001224
4322 Ga0055531_10002330
4323 Ga0055531_10002687
4324 Ga0055531_10002748
4325 Ga0055531_10003738
4326 Ga0055531_10006866
4327 Ga0055531_10008466
4328 Ga0055531_10011033
4329 Ga0055531_10013404
4330 Ga0055531_10019816
4331 Ga0055541_1000013
4332 Ga0055543_1000045
4333 Ga0055543_1000400
4334 Ga0055543_1001093
4335 Ga0055543_1001304
4336 Ga0065165_1000011
4337 Ga0065165_1000239
4338 Ga0065165_1000907
4339 Ga0065165_1001245
4340 Ga0065165_1003901
4341 Ga0065704_10000913
4342 Ga0065704_10002398
4343 Ga0065704_10070148
4344 Ga0065704_10070209
4345 Ga0065704_10070386
4346 Ga0065704_10072392
4347 Ga0065704_10073572
4348 Ga0065712_10000310
4349 Ga0065715_10001068
4350 Ga0065707_10082997
4351 Ga0070658_10000361
4352 Ga0070658_10003762
4353 Ga0070658_10004735
4354 Ga0070658_10008111
4355 Ga0070658_10011334
4356 Ga0070658_10023208
4357 Ga0070676_10002599
4358 Ga0070676_10009251
4359 Ga0070683_100000016
4360 Ga0070683_100001338
4361 Ga0070683_100006728
4362 Ga0070683_100034592
4363 Ga0070683_100069334
4364 Ga0070683_100079311
4365 Ga0070690_100001414
4366 Ga0070690_100019994
4367 Ga0070670_100000843
4368 Ga0070670_100001934
4369 Ga0070670_100012615
4370 Ga0070670_100061127
4371 Ga0070677_10006674
4372 Ga0070677_10019598
4373 Ga0068869_100005151
4374 Ga0068869_100019852
4375 Ga0068869_100024251
4376 Ga0068869_100027424
4377 Ga0070666_10001031
4378 Ga0070666_10021453
4379 Ga0070666_10035255
4380 Ga0070666_10039495
4381 Ga0070680_100003069
4382 Ga0070682_100007364
4383 Ga0070682_100019612
4384 Ga0070682_100032998
4385 Ga0070682_100035669
4386 Ga0068868_100000189
4387 Ga0068868_100092431
4388 Ga0070660_100000453
4389 Ga0070660_100019910
4390 Ga0070660_100077176
4391 Ga0070689_100004325
4392 Ga0070689_100013429
4393 Ga0070689_100021565
4394 Ga0070687_100004260
4395 Ga0070661_100014037
4396 Ga0070661_100053255
4397 Ga0070692_10022372
4398 Ga0070668_100000663
4399 Ga0070668_100003580
4400 Ga0070668_100004005
4401 Ga0070668_100014372
4402 Ga0070668_100048177
4403 Ga0070668_100054233
4404 Ga0070669_100004348
4405 Ga0070669_100014859
4406 Ga0070669_100016068
4407 Ga0070669_100032830
4408 Ga0070669_100034171
4409 Ga0070675_100006892
4410 Ga0070675_100008848
4411 Ga0070675_100010414
4412 Ga0070675_100022653
4413 Ga0070675_100112303
4414 Ga0070671_100002648
4415 Ga0070671_100017761
4416 Ga0070671_100033370
4417 Ga0070671_100040985
4418 Ga0070671_100095690
4419 Ga0070674_100001433
4420 Ga0070674_100004934
4421 Ga0070674_100005296
4422 Ga0070674_100007155
4423 Ga0070674_100015712
4424 Ga0070674_100031780
4425 Ga0070673_100001897
4426 Ga0070673_100002248
4427 Ga0070673_100003189
4428 Ga0070673_100021362
4429 Ga0070673_100035246
4430 Ga0070688_100004918
4431 Ga0070659_100000044
4432 Ga0070659_100002036
4433 Ga0070659_100009166
4434 Ga0070659_100014285
4435 Ga0070659_100047347
4436 Ga0070667_100000568
4437 Ga0070667_100004373
4438 Ga0070667_100004815
4439 Ga0070667_100006832
4440 Ga0070667_100009985
4441 Ga0070667_100012179
4442 Ga0070667_100013535
4443 Ga0070667_100017461
4444 Ga0070667_100036150
4445 Ga0070667_100106889
4446 Ga0070709_10019207
4447 Ga0070709_10023088
4448 Ga0070709_10024646
4449 Ga0070709_10025639
4450 Ga0070709_10035715
4451 Ga0070714_100000012
4452 Ga0070714_100000111
4453 Ga0070714_100000503
4454 Ga0070714_100003404
4455 Ga0070714_100013350
4456 Ga0070714_100025554
4457 Ga0070713_100012733
4458 Ga0070713_100020435
4459 Ga0070713_100029178
4460 Ga0070713_100048342
4461 Ga0070713_100051862
4462 Ga0070713_100077508
4463 Ga0070713_100088761
4464 Ga0070710_10001493
4465 Ga0070710_10003261
4466 Ga0070710_10017407
4467 Ga0070710_10035280
4468 Ga0070701_10018135
4469 Ga0070711_100006992
4470 Ga0070711_100015682
4471 Ga0070711_100017220
4472 Ga0070705_100034687
4473 Ga0070700_100000010
4474 Ga0070700_100003787
4475 Ga0070694_100006416
4476 Ga0070694_100006609
4477 Ga0070694_100035150
4478 Ga0070708_100000445
4479 Ga0070708_100005044
4480 Ga0070663_100000355
4481 Ga0070678_100000623
4482 Ga0070678_100004562
4483 Ga0070678_100017552
4484 Ga0070678_100028398
4485 Ga0070678_100083021
4486 Ga0070662_100000592
4487 Ga0070662_100002736
4488 Ga0070662_100005408
4489 Ga0070662_100009068
4490 Ga0070681_10007707
4491 Ga0070681_10010876
4492 Ga0070681_10016483
4493 Ga0070681_10024247
4494 Ga0070681_10027191
4495 Ga0070681_10027211
4496 Ga0070681_10037995
4497 Ga0070681_10057012
4498 Ga0070681_10105862
4499 Ga0068867_100001767
4500 Ga0068867_100002156
4501 Ga0068867_100004253
4502 Ga0068867_100010372
4503 Ga0068867_100019645
4504 Ga0068867_100021371
4505 Ga0068867_100052977
4506 Ga0070685_10004896
4507 Ga0070706_100000427
4508 Ga0070706_100003818
4509 Ga0070706_100003859
4510 Ga0070706_100016043
4511 Ga0070706_100016490
4512 Ga0070706_100038340
4513 Ga0070707_100000731
4514 Ga0070707_100014623
4515 Ga0070707_100022531
4516 Ga0070707_100032746
4517 Ga0070707_100057704
4518 Ga0070707_100106988
4519 Ga0070698_100000799
4520 Ga0070698_100004397
4521 Ga0070698_100006976
4522 Ga0070698_100014672
4523 Ga0070698_100022793
4524 Ga0070698_100039563
4525 Ga0070698_100047944
4526 Ga0070698_100050657
4527 Ga0070699_100000561
4528 Ga0070699_100002515
4529 Ga0070679_100005118
4530 Ga0070679_100009281
4531 Ga0070679_100010613
4532 Ga0070679_100041021
4533 Ga0070679_100080552
4534 Ga0070684_100000005
4535 Ga0070684_100001665
4536 Ga0070684_100008934
4537 Ga0070684_100016171
4538 Ga0070684_100021998
4539 Ga0070684_100122875
4540 Ga0070697_100060395
4541 Ga0070697_100074583
4542 Ga0070697_100077558
4543 Ga0068853_100000206
4544 Ga0068853_100000817
4545 Ga0068853_100005837
4546 Ga0068853_100009750
4547 Ga0068853_100021311
4548 Ga0068853_100029004
4549 Ga0070672_100003218
4550 Ga0070672_100004006
4551 Ga0070672_100074351
4552 Ga0070686_100001815
4553 Ga0070686_100029815
4554 Ga0070686_100062582
4555 Ga0070695_100017383
4556 Ga0070695_100021479
4557 Ga0070696_100043939
4558 Ga0070693_100005796
4559 Ga0070693_100008593
4560 Ga0070665_100000008
4561 Ga0070665_100001702
4562 Ga0070665_100002610
4563 Ga0070665_100003073
4564 Ga0070665_100015503
4565 Ga0070665_100023874
4566 Ga0070665_100042618
4567 Ga0070665_100068347
4568 Ga0070665_100078736
4569 Ga0070665_100136837
4570 Ga0070704_100018762
4571 Ga0070704_100023018
4572 Ga0070704_100024043
4573 Ga0070704_100029565
4574 Ga0068855_100000030
4575 Ga0068855_100000174
4576 Ga0068855_100000622
4577 Ga0068855_100000899
4578 Ga0068855_100002708
4579 Ga0068855_100007920
4580 Ga0068855_100011705
4581 Ga0068855_100014140
4582 Ga0068855_100016224
4583 Ga0068855_100018840
4584 Ga0068855_100022808
4585 Ga0068855_100023137
4586 Ga0068855_100085801
4587 Ga0068855_100100340
4588 Ga0068855_100104206
4589 Ga0070664_100006445
4590 Ga0070664_100018879
4591 Ga0070664_100029553
4592 Ga0070664_100032882
4593 Ga0070664_100063534
4594 Ga0070664_100070440
4595 Ga0068857_100005288
4596 Ga0068857_100041020
4597 Ga0068854_100000026
4598 Ga0068854_100003476
4599 Ga0068856_100001902
4600 Ga0068856_100007490
4601 Ga0068856_100015703
4602 Ga0068856_100016266
4603 Ga0068856_100087408
4604 Ga0070702_100000205
4605 Ga0070702_100003996
4606 Ga0068852_100002558
4607 Ga0068852_100003282
4608 Ga0068852_100015109
4609 Ga0068852_100093928
4610 Ga0068852_100096161
4611 Ga0068859_100002091
4612 Ga0068859_100016336
4613 Ga0068859_100065985
4614 Ga0068859_100078654
4615 Ga0068859_100092949
4616 Ga0068864_100003970
4617 Ga0068864_100008109
4618 Ga0068864_100025187
4619 Ga0068864_100025482
4620 Ga0068866_10000859
4621 Ga0068861_100000012
4622 Ga0068861_100003932
4623 Ga0068861_100022412
4624 Ga0068861_100034409
4625 Ga0068851_10000623
4626 Ga0068851_10018953
4627 Ga0068870_10018709
4628 Ga0068863_100006371
4629 Ga0068863_100011292
4630 Ga0068863_100020240
4631 Ga0068863_100020675
4632 Ga0068863_100108597
4633 Ga0068858_100000002
4634 Ga0068858_100000882
4635 Ga0068858_100001488
4636 Ga0068858_100002571
4637 Ga0068858_100003070
4638 Ga0068858_100003072
4639 Ga0068858_100004552
4640 Ga0068858_100005302
4641 Ga0068858_100005393
4642 Ga0068858_100019961
4643 Ga0068858_100044210
4644 Ga0068858_100098922
4645 Ga0068860_100000029
4646 Ga0068860_100000142
4647 Ga0068860_100000400
4648 Ga0068860_100000487
4649 Ga0068860_100001623
4650 Ga0068860_100003858
4651 Ga0068860_100021527
4652 Ga0068860_100033772
4653 Ga0068860_100073271
4654 Ga0068860_100083736
4655 Ga0068860_100089001
4656 Ga0068862_100015121
4657 Ga0068862_100019037
4658 Ga0068862_100020519
4659 Ga0068862_100024307
4660 Ga0068862_100031285
4661 Ga0068862_100033003
4662 Ga0068862_100085118
4663 Ga0081455_10000002
4664 Ga0081455_10000047
4665 Ga0081455_10000070
4666 Ga0081455_10000198
4667 Ga0081455_10000921
4668 Ga0081455_10001544
4669 Ga0081455_10003100
4670 Ga0081455_10005985
4671 Ga0081455_10010964
4672 Ga0081455_10024669
4673 Ga0081538_10000602
4674 Ga0081540_1000079
4675 Ga0081540_1000097
4676 Ga0081540_1000654
4677 Ga0081540_1001868
4678 Ga0081540_1002433
4679 Ga0081540_1004752
4680 Ga0081540_1007088
4681 Ga0081540_1009325
4682 Ga0081540_1011079
4683 Ga0081539_10000017
4684 Ga0081539_10000504
4685 Ga0081539_10000705
4686 Ga0081539_10001004
4687 Ga0081539_10001116
4688 Ga0081539_10001133
4689 Ga0081539_10005550
4690 Ga0081539_10006570
4691 Ga0081539_10031152
4692 Ga0070717_10011265
4693 Ga0070717_10012608
4694 Ga0070717_10018731
4695 Ga0070717_10067360
4696 Ga0075365_10000652
4697 Ga0075365_10008082
4698 Ga0075365_10015519
4699 Ga0075365_10026448
4700 Ga0075365_10029207
4701 Ga0075368_10000433
4702 Ga0075368_10003166
4703 Ga0075368_10011855
4704 Ga0075363_100000351
4705 Ga0075363_100016251
4706 Ga0075363_100016577
4707 Ga0075364_10000117
4708 Ga0075364_10002086
4709 Ga0075432_10003895
4710 Ga0070715_10006934
4711 Ga0070716_100000102
4712 Ga0070716_100003015
4713 Ga0070716_100012285
4714 Ga0070712_100009357
4715 Ga0070712_100014517
4716 Ga0070712_100064625
4717 Ga0075362_10001494
4718 Ga0075362_10002201
4719 Ga0075367_10001839
4720 Ga0075367_10004358
4721 Ga0075367_10011083
4722 Ga0075369_10002115
4723 Ga0075369_10005311
4724 Ga0075366_10013063
4725 Ga0097621_100000859
4726 Ga0097621_100003399
4727 Ga0097621_100012112
4728 Ga0097621_100015684
4729 Ga0097621_100020431
4730 Ga0097621_100033850
4731 Ga0097621_100081333
4732 Ga0075370_10000875
4733 Ga0075370_10002068
4734 Ga0075370_10002601
4735 Ga0075370_10002815
4736 Ga0075370_10003792
4737 Ga0075370_10015535
4738 Ga0068871_100000004
4739 Ga0068871_100010340
4740 Ga0068871_100019035
4741 Ga0068871_100058743
4742 Ga0075428_100000658
4743 Ga0075428_100001310
4744 Ga0075428_100003058
4745 Ga0075428_100007864
4746 Ga0075428_100014285
4747 Ga0075428_100018570
4748 Ga0075428_100105528
4749 Ga0075428_100110150
4750 Ga0075428_100111390
4751 Ga0075428_100148811
4752 Ga0075428_100156255
4753 Ga0075430_100000408
4754 Ga0075430_100001396
4755 Ga0075430_100011546
4756 Ga0075430_100012145
4757 Ga0075430_100020676
4758 Ga0075430_100026363
4759 Ga0075430_100040879
4760 Ga0075431_100000386
4761 Ga0075431_100000547
4762 Ga0075431_100003378
4763 Ga0075431_100004011
4764 Ga0075431_100005630
4765 Ga0075431_100009544
4766 Ga0075431_100014429
4767 Ga0075431_100015851
4768 Ga0075431_100020761
4769 Ga0075431_100055623
4770 Ga0075431_100097457
4771 Ga0075433_10001320
4772 Ga0075433_10003371
4773 Ga0075433_10007955
4774 Ga0075433_10011059
4775 Ga0075433_10012860
4776 Ga0075433_10040107
4777 Ga0075434_100005268
4778 Ga0075434_100005620
4779 Ga0075434_100024716
4780 Ga0075434_100031784
4781 Ga0075434_100044296
4782 Ga0075434_100120216
4783 Ga0075429_100000115
4784 Ga0075429_100016489
4785 Ga0075429_100024416
4786 Ga0075429_100024594
4787 Ga0068865_100002862
4788 Ga0068865_100003922
4789 Ga0075436_100005379
4790 Ga0075436_100017190
4791 Ga0075436_100028835
4792 Ga0075436_100034604
4793 Ga0097620_100002091
4794 Ga0097620_100016336
4795 Ga0097620_100065986
4796 Ga0097620_100078655
4797 Ga0097620_100092941
4798 Ga0099823_1000009
4799 Ga0099823_1000013
4800 Ga0099823_1000061
4801 Ga0079104_1000185
4802 Ga0099826_10000004
4803 Ga0075435_100009284
4804 Ga0075435_100017795
4805 Ga0075435_100053881
4806 Ga0099794_10017598
4807 Ga0105251_10000179
4808 Ga0105251_10009224
4809 Ga0105244_10000748
4810 Ga0105244_10003121
4811 Ga0105244_10003800
4812 Ga0105244_10020231
4813 Ga0105244_10029686
4814 Ga0105244_10042139
4815 Ga0105250_10000097
4816 Ga0105250_10000296
4817 Ga0105250_10000506
4818 Ga0105240_10000012
4819 Ga0105240_10000105
4820 Ga0105240_10000200
4821 Ga0105240_10000236
4822 Ga0105240_10001559
4823 Ga0105240_10002719
4824 Ga0105240_10004456
4825 Ga0105240_10012669
4826 Ga0105240_10013551
4827 Ga0105240_10018962
4828 Ga0105240_10034919
4829 Ga0105240_10038828
4830 Ga0105240_10042452
4831 Ga0105240_10044907
4832 Ga0105240_10059425
4833 Ga0105240_10086891
4834 Ga0105240_10099787
4835 Ga0105240_10104499
4836 Ga0111539_10000003
4837 Ga0111539_10007820
4838 Ga0111539_10008250
4839 Ga0111539_10010985
4840 Ga0111539_10012293
4841 Ga0111539_10043542
4842 Ga0111539_10043863
4843 Ga0111539_10062065
4844 Ga0111539_10096248
4845 Ga0105245_10000168
4846 Ga0105245_10002616
4847 Ga0105245_10004266
4848 Ga0105245_10037025
4849 Ga0105245_10041231
4850 Ga0105245_10053313
4851 Ga0105247_10000922
4852 Ga0105247_10006357
4853 Ga0105247_10011398
4854 Ga0114129_10000014
4855 Ga0114129_10001242
4856 Ga0114129_10003040
4857 Ga0114129_10004614
4858 Ga0114129_10012134
4859 Ga0114129_10039676
4860 Ga0114129_10052729
4861 Ga0114129_10066332
4862 Ga0114129_10098880
4863 Ga0105243_10000200
4864 Ga0105243_10000491
4865 Ga0105243_10002310
4866 Ga0105243_10005388
4867 Ga0105243_10039670
4868 Ga0105241_10000052
4869 Ga0105241_10012062
4870 Ga0105241_10015563
4871 Ga0105241_10047072
4872 Ga0105241_10090723
4873 Ga0105242_10004937
4874 Ga0105242_10012996
4875 Ga0105242_10017304
4876 Ga0105242_10026113
4877 Ga0105242_10032872
4878 Ga0105242_10107506
4879 Ga0105248_10000152
4880 Ga0105248_10006731
4881 Ga0105248_10008603
4882 Ga0105248_10014110
4883 Ga0105248_10018307
4884 Ga0105248_10020421
4885 Ga0105248_10046436
4886 Ga0105248_10101309
4887 Ga0105248_10107313
4888 Ga0105237_10000504
4889 Ga0105237_10000941
4890 Ga0105237_10003110
4891 Ga0105237_10011946
4892 Ga0105237_10034192
4893 Ga0105237_10046307
4894 Ga0105237_10052600
4895 Ga0105238_10001421
4896 Ga0105238_10002760
4897 Ga0105238_10007781
4898 Ga0105238_10009963
4899 Ga0105238_10023321
4900 Ga0105238_10036301
4901 Ga0105238_10042326
4902 Ga0105238_10081505
4903 Ga0105249_10000912
4904 Ga0105249_10004063
4905 Ga0105249_10014652
4906 Ga0105249_10035762
4907 Ga0105249_10062007
4908 Ga0105249_10103389
4909 Ga0105239_10000021
4910 Ga0105239_10000028
4911 Ga0105239_10000215
4912 Ga0105239_10001674
4913 Ga0105239_10002939
4914 Ga0105239_10004452
4915 Ga0105239_10004478
4916 Ga0105239_10005115
4917 Ga0105239_10007478
4918 Ga0105239_10009229
4919 Ga0105239_10011353
4920 Ga0105239_10016985
4921 Ga0105239_10018879
4922 Ga0105239_10034621
4923 Ga0105239_10043910
4924 Ga0105246_10002067
4925 Ga0105246_10007825
4926 Ga0157319_1000005
4927 Ga0157319_1000045
4928 Ga0157345_1000004
4929 Ga0157373_10000039
4930 Ga0157373_10002206
4931 Ga0157371_10001056
4932 Ga0157371_10003350
4933 Ga0157371_10016398
4934 Ga0157371_10020105
4935 Ga0157371_10035564
4936 Ga0157370_10000033
4937 Ga0157370_10001210
4938 Ga0157370_10013679
4939 Ga0157370_10035890
4940 Ga0157370_10039286
4941 Ga0157370_10068431
4942 Ga0157369_10000286
4943 Ga0157369_10000755
4944 Ga0157369_10002422
4945 Ga0157369_10002613
4946 Ga0157369_10012015
4947 Ga0157369_10018558
4948 Ga0157369_10024665
4949 Ga0157369_10027518
4950 Ga0157369_10048536
4951 Ga0157369_10092684
4952 Ga0157369_10115686
4953 Ga0171463_1002
4954 Ga0157374_10006408
4955 Ga0157374_10016993
4956 Ga0157374_10018802
4957 Ga0157374_10031633
4958 Ga0157374_10047817
4959 Ga0157374_10052265
4960 Ga0157374_10063580
4961 Ga0157378_10002205
4962 Ga0157378_10007177
4963 Ga0157378_10009599
4964 Ga0157378_10022364
4965 Ga0157378_10022558
4966 Ga0157378_10028442
4967 Ga0163162_10000038
4968 Ga0163162_10000067
4969 Ga0163162_10003048
4970 Ga0163162_10005821
4971 Ga0163162_10025888
4972 Ga0163162_10026613
4973 Ga0163162_10049018
4974 Ga0163162_10051112
4975 Ga0163162_10052652
4976 Ga0163162_10057697
4977 Ga0157372_10000025
4978 Ga0157372_10003028
4979 Ga0157372_10004861
4980 Ga0157372_10013703
4981 Ga0157372_10025920
4982 Ga0157372_10028862
4983 Ga0157372_10063635
4984 Ga0157372_10138956
4985 Ga0157372_10149337
4986 Ga0157375_10001318
4987 Ga0157375_10004413
4988 Ga0157375_10005146
4989 Ga0157375_10008203
4990 Ga0157375_10046027
4991 Ga0157375_10054507
4992 Ga0157375_10067743
4993 Ga0157375_10069616
4994 Ga0157375_10105102
4995 Ga0163163_10010308
4996 Ga0163163_10029990
4997 Ga0163163_10030181
4998 Ga0163163_10069099
4999 Ga0163163_10084060
5000 Ga0163163_10092879
5001 Ga0157380_10085769
5002 Ga0182008_10000416
5003 Ga0182008_10000878
5004 Ga0182008_10002793
5005 Ga0182008_10002818
5006 Ga0182008_10007160
5007 Ga0157379_10000818
5008 Ga0157379_10001008
5009 Ga0157379_10004868
5010 Ga0157379_10013654
5011 Ga0157379_10019309
5012 Ga0157379_10047427
5013 Ga0157376_10017836
5014 Ga0157376_10022530
5015 Ga0157376_10030431
5016 Ga0157376_10079970
5017 Ga0182006_1001162
5018 Ga0182006_1002125
5019 Ga0182006_1002930
5020 Ga0182006_1003319
5021 Ga0182006_1016169
5022 Ga0182006_1020708
5023 Ga0182007_10000129
5024 Ga0182007_10000898
5025 Ga0182005_1000041
5026 Ga0182005_1000983
5027 Ga0182005_1001321
5028 Ga0182005_1001545
5029 Ga0182005_1002029
5030 Ga0182005_1004034
5031 Ga0183367_1001
5032 Ga0183367_1011
5033 Ga0183360_10001
5034 Ga0183363_1005
5035 Ga0183363_1016
5036 Ga0163161_10000118
5037 Ga0163161_10000204
5038 Ga0163161_10003943
5039 Ga0163161_10007685
5040 Ga0163161_10014664
5041 Ga0197907_10246874
5042 Ga0197907_10265824
5043 Ga0197907_10354024
5044 Ga0197907_10604847
5045 Ga0197907_11480787
5046 Ga0206349_1392433
5047 Ga0206355_1197704
5048 Ga0206355_1582971
5049 Ga0206351_10617994
5050 Ga0206351_10899598
5051 Ga0206352_11224536
5052 Ga0206350_10623975
5053 Ga0206350_10780144
5054 Ga0206350_11459509
5055 Ga0206350_11632907
5056 Ga0206354_10686772
5057 Ga0206354_11080053
5058 Ga0206353_10956205
5059 Ga0206353_11797530
5060 Ga0213872_10000007
5061 Ga0213872_10000009
5062 Ga0213872_10000294
5063 Ga0213872_10001640
5064 Ga0213872_10002442
5065 Ga0213872_10002518
5066 Ga0213872_10003221
5067 Ga0213872_10004311
5068 Ga0213872_10033137
5069 Ga0213872_10033236
5070 Ga0213876_10000044
5071 Ga0213876_10005060
5072 Ga0213876_10011078
5073 Ga0213876_10024216
5074 Ga0213876_10024547
5075 Ga0213875_10000001
5076 Ga0213875_10012272
5077 Ga0224712_10005372
5078 Ga0224712_10007551
5079 Ga0224712_10007872
5080 Ga0224712_10008846
5081 Ga0224712_10011594
5082 Ga0224712_10013267
5083 Ga0224712_10016741
5084 Ga0224572_1000806
5085 Ga0228598_1000607
5086 Ga0228598_1001912
5087 Ga0209435_100014
5088 Ga0209435_100025
5089 Ga0209760_100013
5090 Ga0209760_100107
5091 Ga0209436_100004
5092 Ga0209436_100394
5093 Ga0209436_100574
5094 Ga0209784_100005
5095 Ga0209566_100005
5096 Ga0209674_100009
5097 Ga0209674_100067
5098 Ga0209672_100005
5099 Ga0209672_100100
5100 Ga0209672_104894
5101 Ga0209563_100012
5102 Ga0209563_100023
5103 Ga0209563_100044
5104 Ga0209563_100068
5105 Ga0207427_100003
5106 Ga0207427_100011
5107 Ga0207427_100113
5108 Ga0207427_100458
5109 Ga0209437_100002
5110 Ga0209437_100010
5111 Ga0209437_100022
5112 Ga0209437_100025
5113 Ga0209258_100006
5114 Ga0209258_100024
5115 Ga0209258_100111
5116 Ga0209258_100129
5117 Ga0209258_100891
5118 Ga0207425_1000161
5119 Ga0207425_1000177
5120 Ga0207425_1004810
5121 Ga0209646_1000001
5122 Ga0209646_1000083
5123 Ga0209646_1000244
5124 Ga0209026_1000004
5125 Ga0209026_1000074
5126 Ga0209026_1000078
5127 Ga0209026_1000137
5128 Ga0209026_1000472
5129 Ga0209026_1003602
5130 Ga0209026_1004856
5131 Ga0209677_100006
5132 Ga0209677_100049
5133 Ga0209677_100260
5134 Ga0209677_101106
5135 Ga0209148_1000009
5136 Ga0209148_1000012
5137 Ga0209148_1000078
5138 Ga0209148_1000099
5139 Ga0209148_1001201
5140 Ga0209759_1000003
5141 Ga0209759_1000013
5142 Ga0209759_1000060
5143 Ga0209759_1000110
5144 Ga0209759_1001172
5145 Ga0209759_1001705
5146 Ga0209759_1002076
5147 Ga0209129_1000060
5148 Ga0209129_1000226
5149 Ga0209129_1000861
5150 Ga0209129_1004906
5151 Ga0209129_1009710
5152 Ga0209233_1000004
5153 Ga0209233_1000012
5154 Ga0209233_1000013
5155 Ga0209233_1000017
5156 Ga0209233_1000031
5157 Ga0209233_1000146
5158 Ga0209233_1000975
5159 Ga0209565_1000001
5160 Ga0209565_1000028
5161 Ga0209565_1002390
5162 Ga0209565_1003461
5163 Ga0207666_1000399
5164 Ga0209455_1000008
5165 Ga0209455_1000029
5166 Ga0209455_1000083
5167 Ga0209455_1000194
5168 Ga0209455_1000196
5169 Ga0209673_1000001
5170 Ga0209673_1000035
5171 Ga0209673_1000239
5172 Ga0209673_1004737
5173 Ga0209130_1000001
5174 Ga0209130_1000033
5175 Ga0209130_1000052
5176 Ga0209130_1000118
5177 Ga0209130_1001938
5178 Ga0209130_1002223
5179 Ga0209675_1000001
5180 Ga0209675_1000111
5181 Ga0209675_1000291
5182 Ga0209675_1003688
5183 Ga0209675_1004607
5184 Ga0209675_1004636
5185 Ga0209676_1000020
5186 Ga0209676_1000054
5187 Ga0209676_1000059
5188 Ga0209676_1000071
5189 Ga0209676_1000102
5190 Ga0209676_1001068
5191 Ga0209025_1000015
5192 Ga0209025_1000032
5193 Ga0209025_1000086
5194 Ga0209025_1000224
5195 Ga0209025_1000446
5196 Ga0209025_1000447
5197 Ga0209025_1000523
5198 Ga0209025_1000879
5199 Ga0209025_1002317
5200 Ga0209025_1003762
5201 Ga0209025_1003784
5202 Ga0209025_1009138
5203 Ga0209564_1000001
5204 Ga0209564_1000087
5205 Ga0209564_1000147
5206 Ga0209564_1000671
5207 Ga0209564_1001181
5208 Ga0209564_1001242
5209 Ga0209564_1002245
5210 Ga0209564_1003175
5211 Ga0209564_1005637
5212 Ga0209758_1000013
5213 Ga0209758_1000130
5214 Ga0209758_1000634
5215 Ga0209758_1000760
5216 Ga0209758_1000856
5217 Ga0209758_1001111
5218 Ga0209758_1001449
5219 Ga0209758_1014694
5220 Ga0209758_1023003
5221 Ga0209050_1000066
5222 Ga0209050_1000105
5223 Ga0209050_1000219
5224 Ga0209050_1001192
5225 Ga0209050_1003009
5226 Ga0209050_1003349
5227 Ga0209050_1003542
5228 Ga0209050_1004443
5229 Ga0209050_1006689
5230 Ga0209050_1007400
5231 Ga0209256_1000002
5232 Ga0209256_1000003
5233 Ga0209256_1000064
5234 Ga0209256_1000177
5235 Ga0209256_1000326
5236 Ga0209256_1000373
5237 Ga0209256_1000575
5238 Ga0209256_1000812
5239 Ga0209256_1001157
5240 Ga0209256_1003246
5241 Ga0209256_1005541
5242 Ga0207426_1000005
5243 Ga0207426_1000078
5244 Ga0207426_1000151
5245 Ga0207426_1000197
5246 Ga0207426_1000396
5247 Ga0207426_1002057
5248 Ga0207426_1005479
5249 Ga0209051_1000021
5250 Ga0209051_1000044
5251 Ga0209051_1000066
5252 Ga0209051_1000511
5253 Ga0209051_1000732
5254 Ga0209051_1000845
5255 Ga0209051_1000955
5256 Ga0209051_1002656
5257 Ga0209051_1005027
5258 Ga0209051_1009862
5259 Ga0209257_1000010
5260 Ga0209257_1000055
5261 Ga0209257_1000082
5262 Ga0209257_1000124
5263 Ga0209257_1000347
5264 Ga0209257_1000593
5265 Ga0209257_1001482
5266 Ga0209257_1002346
5267 Ga0209257_1002422
5268 Ga0209257_1002704
5269 Ga0209257_1003444
5270 Ga0209257_1003909
5271 Ga0209257_1003910
5272 Ga0209257_1004374
5273 Ga0209257_1004460
5274 Ga0209257_1004547
5275 Ga0209257_1009180
5276 Ga0207697_10005455
5277 Ga0207656_10006762
5278 Ga0207696_1000016
5279 Ga0207696_1000051
5280 Ga0207696_1000103
5281 Ga0207696_1000548
5282 Ga0207696_1003040
5283 Ga0207655_1000051
5284 Ga0207655_1000080
5285 Ga0207655_1000497
5286 Ga0207655_1001260
5287 Ga0207655_1004155
5288 Ga0207713_1000087
5289 Ga0207713_1000199
5290 Ga0207713_1002190
5291 Ga0207713_1002994
5292 Ga0207713_1007237
5293 Ga0207713_1009463
5294 Ga0207713_1012694
5295 Ga0207682_10000414
5296 Ga0207692_10007812
5297 Ga0207692_10008574
5298 Ga0207692_10023110
5299 Ga0207642_10014229
5300 Ga0207710_10000286
5301 Ga0207710_10006680
5302 Ga0207710_10009564
5303 Ga0207688_10021256
5304 Ga0207688_10021676
5305 Ga0207688_10023595
5306 Ga0207680_10005760
5307 Ga0207647_10000210
5308 Ga0207647_10000720
5309 Ga0207647_10001799
5310 Ga0207647_10003487
5311 Ga0207647_10006330
5312 Ga0207647_10026081
5313 Ga0207647_10043559
5314 Ga0207685_10000387
5315 Ga0207699_10001430
5316 Ga0207699_10005406
5317 Ga0207699_10032810
5318 Ga0207645_10000168
5319 Ga0207645_10000682
5320 Ga0207645_10002229
5321 Ga0207645_10010229
5322 Ga0207645_10040044
5323 Ga0207643_10015268
5324 Ga0207643_10018676
5325 Ga0207643_10023177
5326 Ga0207705_10004586
5327 Ga0207705_10005000
5328 Ga0207705_10006256
5329 Ga0207705_10015414
5330 Ga0207705_10046973
5331 Ga0207684_10000408
5332 Ga0207684_10001773
5333 Ga0207684_10014461
5334 Ga0207684_10017361
5335 Ga0207684_10021772
5336 Ga0207684_10085867
5337 Ga0207654_10000011
5338 Ga0207707_10008910
5339 Ga0207707_10027852
5340 Ga0207707_10048503
5341 Ga0207695_10000055
5342 Ga0207695_10000110
5343 Ga0207695_10000120
5344 Ga0207695_10000193
5345 Ga0207695_10000244
5346 Ga0207695_10000422
5347 Ga0207695_10000573
5348 Ga0207695_10000699
5349 Ga0207695_10005405
5350 Ga0207695_10008626
5351 Ga0207695_10018747
5352 Ga0207695_10030747
5353 Ga0207695_10033882
5354 Ga0207695_10051167
5355 Ga0207695_10060724
5356 Ga0207695_10084490
5357 Ga0207695_10127069
5358 Ga0207671_10000023
5359 Ga0207671_10005289
5360 Ga0207671_10048302
5361 Ga0207671_10080222
5362 Ga0207693_10002335
5363 Ga0207693_10003454
5364 Ga0207693_10003791
5365 Ga0207693_10028938
5366 Ga0207693_10031079
5367 Ga0207663_10018178
5368 Ga0207660_10038651
5369 Ga0207662_10005289
5370 Ga0207662_10008678
5371 Ga0207662_10014907
5372 Ga0207657_10001230
5373 Ga0207657_10003524
5374 Ga0207657_10007575
5375 Ga0207657_10011638
5376 Ga0207657_10041457
5377 Ga0207657_10044844
5378 Ga0207657_10045741
5379 Ga0207657_10058278
5380 Ga0207657_10060856
5381 Ga0207652_10000328
5382 Ga0207652_10009089
5383 Ga0207652_10019382
5384 Ga0207652_10054874
5385 Ga0207646_10000056
5386 Ga0207646_10004705
5387 Ga0207646_10010105
5388 Ga0207646_10011399
5389 Ga0207646_10024672
5390 Ga0207646_10061335
5391 Ga0207646_10063087
5392 Ga0207646_10091948
5393 Ga0207681_10002122
5394 Ga0207681_10008445
5395 Ga0207681_10014176
5396 Ga0207681_10015921
5397 Ga0207681_10018391
5398 Ga0207681_10028155
5399 Ga0207694_10000505
5400 Ga0207694_10000692
5401 Ga0207694_10007696
5402 Ga0207694_10021655
5403 Ga0207694_10046636
5404 Ga0207694_10080797
5405 Ga0207650_10001797
5406 Ga0207650_10006071
5407 Ga0207650_10021131
5408 Ga0207650_10091198
5409 Ga0207659_10001249
5410 Ga0207659_10006421
5411 Ga0207659_10010648
5412 Ga0207659_10019505
5413 Ga0207659_10028885
5414 Ga0207687_10000604
5415 Ga0207687_10022151
5416 Ga0207687_10023489
5417 Ga0207687_10033044
5418 Ga0207687_10054800
5419 Ga0207700_10000144
5420 Ga0207700_10001951
5421 Ga0207700_10027138
5422 Ga0207700_10061532
5423 Ga0207700_10062854
5424 Ga0207700_10071621
5425 Ga0207664_10000003
5426 Ga0207664_10000121
5427 Ga0207664_10000127
5428 Ga0207664_10000600
5429 Ga0207664_10028796
5430 Ga0207664_10046745
5431 Ga0207664_10080016
5432 Ga0207644_10002833
5433 Ga0207644_10004011
5434 Ga0207644_10021746
5435 Ga0207644_10026809
5436 Ga0207644_10028283
5437 Ga0207690_10000041
5438 Ga0207690_10007513
5439 Ga0207690_10041278
5440 Ga0207690_10050982
5441 Ga0207706_10001233
5442 Ga0207706_10002666
5443 Ga0207706_10009306
5444 Ga0207706_10014783
5445 Ga0207686_10011026
5446 Ga0207686_10021709
5447 Ga0207686_10033684
5448 Ga0207709_10000011
5449 Ga0207709_10000038
5450 Ga0207709_10050858
5451 Ga0207670_10081165
5452 Ga0207669_10001951
5453 Ga0207669_10005640
5454 Ga0207669_10006284
5455 Ga0207704_10003009
5456 Ga0207704_10008207
5457 Ga0207704_10021966
5458 Ga0207665_10000523
5459 Ga0207665_10002828
5460 Ga0207665_10004516
5461 Ga0207665_10021336
5462 Ga0207665_10024729
5463 Ga0207665_10075515
5464 Ga0207691_10000186
5465 Ga0207691_10003047
5466 Ga0207691_10003099
5467 Ga0207691_10007820
5468 Ga0207691_10010363
5469 Ga0207691_10018372
5470 Ga0207691_10019616
5471 Ga0207691_10023608
5472 Ga0207691_10032352
5473 Ga0207691_10055267
5474 Ga0207711_10000409
5475 Ga0207711_10010354
5476 Ga0207711_10011306
5477 Ga0207711_10011447
5478 Ga0207711_10024439
5479 Ga0207711_10058807
5480 Ga0207711_10072629
5481 Ga0207689_10005308
5482 Ga0207689_10005887
5483 Ga0207689_10009946
5484 Ga0207689_10010043
5485 Ga0207689_10013537
5486 Ga0207689_10019434
5487 Ga0207689_10022087
5488 Ga0207661_10000033
5489 Ga0207661_10001439
5490 Ga0207661_10002341
5491 Ga0207661_10007698
5492 Ga0207661_10008000
5493 Ga0207661_10013671
5494 Ga0207661_10016885
5495 Ga0207661_10018909
5496 Ga0207661_10025887
5497 Ga0207679_10032517
5498 Ga0207667_10000053
5499 Ga0207667_10000077
5500 Ga0207667_10000082
5501 Ga0207667_10001623
5502 Ga0207667_10003300
5503 Ga0207667_10009695
5504 Ga0207667_10013523
5505 Ga0207667_10014678
5506 Ga0207667_10017152
5507 Ga0207667_10036276
5508 Ga0207667_10135932
5509 Ga0207651_10021587
5510 Ga0207651_10025070
5511 Ga0207651_10046299
5512 Ga0207712_10000320
5513 Ga0207712_10008144
5514 Ga0207712_10035781
5515 Ga0207712_10037545
5516 Ga0207712_10056977
5517 Ga0207668_10006186
5518 Ga0207668_10008260
5519 Ga0207668_10030968
5520 Ga0207668_10034351
5521 Ga0207640_10000032
5522 Ga0207640_10000747
5523 Ga0207640_10033425
5524 Ga0207658_10000927
5525 Ga0207658_10001058
5526 Ga0207658_10005237
5527 Ga0207658_10014146
5528 Ga0207658_10048498
5529 Ga0207658_10056932
5530 Ga0207658_10072029
5531 Ga0207658_10097805
5532 Ga0207703_10000001
5533 Ga0207703_10000728
5534 Ga0207703_10003865
5535 Ga0207703_10006001
5536 Ga0207703_10007605
5537 Ga0207703_10036520
5538 Ga0207703_10045844
5539 Ga0207703_10052196
5540 Ga0207703_10102324
5541 Ga0207639_10000005
5542 Ga0207639_10002503
5543 Ga0207639_10004093
5544 Ga0207639_10035057
5545 Ga0207639_10079774
5546 Ga0207678_10000179
5547 Ga0207678_10007559
5548 Ga0207678_10011859
5549 Ga0207678_10012130
5550 Ga0207678_10025712
5551 Ga0207678_10043302
5552 Ga0207708_10000006
5553 Ga0207708_10005144
5554 Ga0207708_10006680
5555 Ga0207708_10012001
5556 Ga0207708_10033201
5557 Ga0207702_10000525
5558 Ga0207702_10006743
5559 Ga0207702_10008941
5560 Ga0207702_10067333
5561 Ga0207641_10000217
5562 Ga0207641_10028840
5563 Ga0207641_10088471
5564 Ga0207648_10002813
5565 Ga0207648_10003810
5566 Ga0207648_10007234
5567 Ga0207648_10008327
5568 Ga0207648_10013011
5569 Ga0207648_10018249
5570 Ga0207648_10020830
5571 Ga0207648_10026339
5572 Ga0207648_10084681
5573 Ga0207676_10009489
5574 Ga0207676_10015070
5575 Ga0207676_10023159
5576 Ga0207676_10053534
5577 Ga0207676_10073295
5578 Ga0207674_10007884
5579 Ga0207674_10008783
5580 Ga0207674_10016151
5581 Ga0207674_10030951
5582 Ga0207674_10031424
5583 Ga0207674_10045540
5584 Ga0207674_10069985
5585 Ga0207675_100000055
5586 Ga0207675_100007771
5587 Ga0207675_100011656
5588 Ga0207675_100024613
5589 Ga0207675_100030431
5590 Ga0207683_10000339
5591 Ga0207683_10002436
5592 Ga0207683_10002776
5593 Ga0207683_10004717
5594 Ga0207683_10008428
5595 Ga0207683_10013088
5596 Ga0207683_10020543
5597 Ga0207683_10022357
5598 Ga0207683_10028952
5599 Ga0207683_10039345
5600 Ga0207683_10045873
5601 Ga0207698_10001920
5602 Ga0207698_10009748
5603 Ga0207698_10040178
5604 Ga0207698_10075403
5605 Ga0209281_1000567
5606 Ga0209281_1002352
5607 Ga0209389_1000042
5608 Ga0209389_1004076
5609 Ga0209371_1005052
5610 Ga0209282_1000078
5611 Ga0209966_1000111
5612 Ga0209966_1000862
5613 Ga0209813_10000377
5614 Ga0209813_10003436
5615 Ga0209974_10011857
5616 Ga0207428_10000001
5617 Ga0207428_10002582
5618 Ga0207428_10004979
5619 Ga0207428_10017461
5620 Ga0207428_10040825
5621 Ga0207428_10048325
5622 Ga0268266_10000007
5623 Ga0268266_10000016
5624 Ga0268266_10000813
5625 Ga0268266_10003267
5626 Ga0268266_10015175
5627 Ga0268266_10028593
5628 Ga0268266_10031278
5629 Ga0268266_10074052
5630 Ga0268265_10008131
5631 Ga0268265_10011713
5632 Ga0268265_10020761
5633 Ga0268265_10021243
5634 Ga0268265_10038200
5635 Ga0268265_10080083
5636 Ga0268264_10000058
5637 Ga0268264_10000060
5638 Ga0268264_10000072
5639 Ga0268264_10000227
5640 Ga0268264_10000320
5641 Ga0268264_10015499
5642 Ga0268264_10016398
5643 Ga0268264_10025553
5644 Ga0268264_10032454
5645 Ga0268264_10073881
5646 Ga0268264_10093780
5647 Ga0265337_1000089
5648 Ga0265337_1001912
5649 Ga0265337_1002082
5650 Ga0265326_10005997
5651 Ga0265319_1000326
5652 Ga0265319_1001250
5653 Ga0265319_1002294
5654 Ga0265319_1005146
5655 Ga0265334_10000611
5656 Ga0265334_10000988
5657 Ga0265334_10001152
5658 Ga0265334_10001920
5659 Ga0265318_10000320
5660 Ga0265318_10000462
5661 Ga0265318_10001882
5662 Ga0265318_10004511
5663 Ga0265323_10000943
5664 Ga0265322_10000083
5665 Ga0265336_10000087
5666 Ga0265336_10000211
5667 Ga0265336_10000287
5668 Ga0265336_10006858
5669 Ga0265336_10007251
5670 Ga0307517_10000463
5671 Ga0307517_10008151
5672 Ga0307517_10066418
5673 Ga0307517_10081510
5674 Ga0307515_10000001
5675 Ga0307515_10000013
5676 Ga0307515_10000025
5677 Ga0307515_10000041
5678 Ga0307515_10000048
5679 Ga0307515_10000154
5680 Ga0307515_10000459
5681 Ga0307515_10000486
5682 Ga0307515_10001559
5683 Ga0307515_10003221
5684 Ga0307515_10005985
5685 Ga0307515_10007036
5686 Ga0307515_10032140
5687 Ga0307515_10050447
5688 Ga0307515_10060754
5689 Ga0307515_10070109
5690 Ga0307515_10082625
5691 Ga0307515_10095702
5692 Ga0265338_10000081
5693 Ga0265338_10000691
5694 Ga0265338_10001887
5695 Ga0265338_10001991
5696 Ga0265338_10002478
5697 Ga0265338_10002823
5698 Ga0265338_10003841
5699 Ga0265338_10004581
5700 Ga0265338_10007083
5701 Ga0265338_10007975
5702 Ga0265338_10013392
5703 Ga0265338_10019945
5704 Ga0265338_10022004
5705 Ga0265338_10022705
5706 Ga0265338_10028855
5707 Ga0265338_10050672
5708 Ga0265338_10095320
5709 Ga0265324_10000006
5710 Ga0265324_10000334
5711 Ga0265324_10003068
5712 Ga0265324_10012386
5713 Ga0268256_1007398
5714 Ga0307511_10000247
5715 Ga0307511_10000444
5716 Ga0307511_10036457
5717 Ga0307512_10005187
5718 Ga0307512_10020785
5719 Ga0307512_10081124
5720 Ga0316176_1130274
5721 Ga0316180_1114296
5722 Ga0316181_1007874
5723 Ga0316182_1025613
5724 Ga0265762_1002651
5725 Ga0265760_10000248
5726 Ga0265760_10000332
5727 Ga0265760_10000358
5728 Ga0265760_10000410
5729 Ga0265330_10000784
5730 Ga0265330_10001427
5731 Ga0265330_10001746
5732 Ga0265330_10002244
5733 Ga0265330_10011194
5734 Ga0265330_10023167
5735 Ga0265332_10000014
5736 Ga0265332_10000591
5737 Ga0265332_10000715
5738 Ga0265332_10000787
5739 Ga0265332_10009209
5740 Ga0265332_10015209
5741 Ga0265332_10019555
5742 Ga0265332_10019852
5743 Ga0265328_10004390
5744 Ga0265328_10005324
5745 Ga0265328_10007575
5746 Ga0265320_10001105
5747 Ga0265320_10001453
5748 Ga0265320_10004309
5749 Ga0265320_10006412
5750 Ga0265320_10010585
5751 Ga0265325_10000057
5752 Ga0265325_10000090
5753 Ga0265325_10000171
5754 Ga0265325_10001865
5755 Ga0265325_10009232
5756 Ga0265329_10000050
5757 Ga0265329_10001723
5758 Ga0265329_10004705
5759 Ga0265340_10001347
5760 Ga0265340_10001481
5761 Ga0265340_10001562
5762 Ga0265340_10005284
5763 Ga0265340_10006434
5764 Ga0265340_10007396
5765 Ga0265340_10010721
5766 Ga0265340_10010740
5767 Ga0265340_10011303
5768 Ga0265340_10011533
5769 Ga0265340_10016444
5770 Ga0265339_10000003
5771 Ga0265339_10000409
5772 Ga0265339_10001817
5773 Ga0265339_10002198
5774 Ga0265339_10005831
5775 Ga0265339_10007035
5776 Ga0265339_10007187
5777 Ga0265339_10009328
5778 Ga0265339_10011602
5779 Ga0265339_10017438
5780 Ga0265331_10000018
5781 Ga0265331_10000135
5782 Ga0265331_10000462
5783 Ga0265331_10000772
5784 Ga0265331_10000918
5785 Ga0265331_10000995
5786 Ga0265331_10029138
5787 Ga0265327_10000009
5788 Ga0265327_10000053
5789 Ga0265327_10000167
5790 Ga0265327_10000395
5791 Ga0265327_10002336
5792 Ga0265327_10002544
5793 Ga0265327_10003367
5794 Ga0265327_10009856
5795 Ga0265327_10011154
5796 Ga0265327_10018536
5797 Ga0265316_10000018
5798 Ga0265316_10000531
5799 Ga0265316_10000894
5800 Ga0265316_10001399
5801 Ga0265316_10002273
5802 Ga0265316_10002344
5803 Ga0265316_10004704
5804 Ga0265316_10006329
5805 Ga0265316_10010854
5806 Ga0265316_10023783
5807 Ga0265316_10038432
5808 Ga0265316_10039697
5809 Ga0265316_10044234
5810 Ga0265316_10059083
5811 Ga0307513_10001044
5812 Ga0307513_10005286
5813 Ga0307513_10008631
5814 Ga0307513_10009082
5815 Ga0307513_10019288
5816 Ga0307513_10035630
5817 Ga0307513_10035720
5818 Ga0307513_10064738
5819 Ga0307513_10065585
5820 Ga0307509_10000021
5821 Ga0307509_10000227
5822 Ga0307509_10003935
5823 Ga0307509_10006755
5824 Ga0307509_10033644
5825 Ga0307509_10081031
5826 Ga0307408_100000099
5827 Ga0307408_100000533
5828 Ga0307408_100002044
5829 Ga0307408_100002272
5830 Ga0307408_100004728
5831 Ga0307408_100004965
5832 Ga0307408_100005262
5833 Ga0307408_100005318
5834 Ga0307408_100006412
5835 Ga0307408_100006916
5836 Ga0307408_100010994
5837 Ga0307408_100016934
5838 Ga0265313_10000297
5839 Ga0265313_10000480
5840 Ga0265313_10000682
5841 Ga0265313_10002329
5842 Ga0265313_10005333
5843 Ga0265313_10006516
5844 Ga0265313_10007558
5845 Ga0307508_10000002
5846 Ga0307508_10006061
5847 Ga0307508_10009092
5848 Ga0307508_10012214
5849 Ga0307508_10039182
5850 Ga0307514_10000225
5851 Ga0307514_10004257
5852 Ga0307514_10008829
5853 Ga0307514_10024693
5854 Ga0307514_10047406
5855 Ga0316575_10000299
5856 Ga0316575_10005494
5857 Ga0316575_10007729
5858 Ga0316575_10012953
5859 Ga0316575_10018679
5860 Ga0316579_10000129
5861 Ga0316579_10001365
5862 Ga0316579_10005498
5863 Ga0316579_10006842
5864 Ga0316579_10012402
5865 Ga0316579_10014558
5866 Ga0265314_10000033
5867 Ga0265314_10000060
5868 Ga0265314_10000598
5869 Ga0265314_10000980
5870 Ga0265314_10001517
5871 Ga0265314_10003049
5872 Ga0265314_10004914
5873 Ga0265314_10006367
5874 Ga0265314_10034089
5875 Ga0265314_10040803
5876 Ga0265314_10044339
5877 Ga0265314_10052963
5878 Ga0265342_10000323
5879 Ga0265342_10000411
5880 Ga0265342_10000694
5881 Ga0265342_10000736
5882 Ga0265342_10001775
5883 Ga0265342_10002317
5884 Ga0265342_10004387
5885 Ga0265342_10007065
5886 Ga0265342_10009055
5887 Ga0265342_10011940
5888 Ga0265342_10020145
5889 Ga0265342_10027471
5890 Ga0265342_10036367
5891 Ga0265342_10037112
5892 Ga0316576_10000024
5893 Ga0316576_10000071
5894 Ga0316576_10000764
5895 Ga0316576_10005188
5896 Ga0316576_10007255
5897 Ga0316576_10008388
5898 Ga0316576_10008565
5899 Ga0316576_10012077
5900 Ga0316576_10014607
5901 Ga0316576_10016219
5902 Ga0316576_10018221
5903 Ga0316576_10019376
5904 Ga0316576_10022953
5905 Ga0316576_10030187
5906 Ga0316576_10039113
5907 Ga0316576_10054004
5908 Ga0316578_10000048
5909 Ga0316578_10001187
5910 Ga0316578_10001523
5911 Ga0316578_10003475
5912 Ga0316578_10003983
5913 Ga0316578_10006413
5914 Ga0316578_10007810
5915 Ga0316578_10008377
5916 Ga0316578_10011532
5917 Ga0316578_10017828
5918 Ga0316578_10023412
5919 Ga0307516_10002072
5920 Ga0307516_10006635
5921 Ga0307516_10006716
5922 Ga0307516_10006747
5923 Ga0307516_10009471
5924 Ga0307516_10011016
5925 Ga0307516_10021146
5926 Ga0307516_10036321
5927 Ga0307516_10051920
5928 Ga0307405_10019762
5929 Ga0307405_10028626
5930 Ga0316577_10000013
5931 Ga0316577_10000486
5932 Ga0316577_10000726
5933 Ga0316577_10000879
5934 Ga0316577_10001705
5935 Ga0316577_10003369
5936 Ga0316577_10004342
5937 Ga0316577_10005780
5938 Ga0316577_10015129
5939 Ga0316577_10017800
5940 Ga0316577_10018644
5941 Ga0316577_10019833
5942 Ga0316577_10028439
5943 Ga0316577_10035144
5944 Ga0316577_10052788
5945 Ga0307413_10001336
5946 Ga0307518_10000723
5947 Ga0307518_10000846
5948 Ga0307518_10003635
5949 Ga0307410_10000761
5950 Ga0307410_10006522
5951 Ga0307410_10027814
5952 Ga0307410_10032467
5953 Ga0326468_10000088
5954 Ga0307406_10000092
5955 Ga0307406_10000237
5956 Ga0307406_10016467
5957 Ga0307406_10019467
5958 Ga0307406_10019524
5959 Ga0307406_10025621
5960 Ga0307406_10048969
5961 Ga0307407_10011327
5962 Ga0307412_10000397
5963 Ga0307412_10001632
5964 Ga0307409_100000547
5965 Ga0307409_100002382
5966 Ga0307409_100009212
5967 Ga0307409_100024237
5968 Ga0307409_100037523
5969 Ga0307409_100048930
5970 Ga0307409_100076926
5971 Ga0307416_100014523
5972 Ga0307416_100036651
5973 Ga0307416_100040841
5974 Ga0307414_10000021
5975 Ga0307414_10010322
5976 Ga0307414_10013211
5977 Ga0307414_10026789
5978 Ga0307414_10040352
5979 Ga0307411_10000850
5980 Ga0307411_10005606
5981 Ga0307411_10012503
5982 Ga0307411_10060639
5983 Ga0307415_100026178
5984 Ga0307415_100041010
5985 Ga0307415_100053861
5986 Ga0307415_100055861
5987 Ga0307415_100057927
5988 Ga0316583_10000761
5989 Ga0316583_10003076
5990 Ga0316583_10003395
5991 Ga0316583_10009011
5992 Ga0316583_10009174
5993 Ga0316583_10010138
5994 Ga0316583_10019119
5995 Ga0316585_10001415
5996 Ga0316585_10001966
5997 Ga0316585_10006140
5998 Ga0316585_10011225
5999 Ga0316580_10000682
6000 Ga0316580_10005250
6001 Ga0316593_10004904
6002 Ga0316593_10006162
6003 Ga0316593_10007699
6004 Ga0316593_10008207
6005 Ga0316593_10010479
6006 Ga0316593_10012213
6007 Ga0316593_10013115
6008 Ga0316593_10014689
6009 Ga0316593_10014870
6010 Ga0316593_10014990
6011 Ga0316593_10015238
6012 Ga0316593_10015891
6013 Ga0307507_10000764
6014 Ga0307507_10027656
6015 Ga0307510_10000006
6016 Ga0307510_10001104
6017 Ga0307510_10001430
6018 Ga0307510_10010763
6019 Ga0316592_1006505
6020 Ga0316588_1006135
6021 Ga0316587_1002665
6022 Ga0316596_1002255
6023 Ga0316596_1004605
6024 Ga0316596_1005559
6025 Ga0316596_1006826
6026 Ga0316596_1008568
6027 Ga0316596_1009394
6028 Ga0316596_1010264
6029 Ga0373930_0000005
6030 Ga0373950_0000295
6031 Ga0373926_0002385
6032 Ga0373928_0002740
6033 Ga0373934_0000584
6034 Ga0373934_0001074
6035 Ga0373934_0002102
6036 Ga0373934_0011679
6037 Ga0373944_0001330
6038 Ga0373949_0000302
6039 Ga0373951_0000351
6040 Ga0373923_0001855
6041 Ga0373923_0008382
6042 Ga0373932_0001672
6043 Ga0373936_0001272
6044 Ga0373936_0001976
6045 Ga0373936_0007897
6046 Ga0373939_0000006
6047 Ga0373945_0011884
6048 Ga0373953_0000250
6049 Ga0373953_0009144
6050 Ga0373954_0000176
6051 Ga0373954_0002093
6052 Ga0373954_0007677
6053 Ga0373954_0024207
6054 Ga0373956_0000504
6055 Ga0373956_0000928
6056 Ga0373956_0001082
6057 Ga0373957_0000456
6058 Ga0373957_0011693
6059 Ga0373957_0012209
6060 Ga0373960_0003249
6061 Ga0373943_0000195
6062 Ga0373943_0002027
6063 Ga0373946_0000776
6064 Ga0373946_0001374
6065 Ga0373955_0000490
6066 Ga0373955_0019033
6067 Ga0373955_0020652
6068 Ga0373961_0000540
6069 Ga0373961_0000828
6070 Ga0373961_0005021
6071 Ga0373961_0006558
6072 Ga0373961_0007705
6073 Ga0373962_0005253
6074 Ga0373962_0005441
6075 Ga0316574_0000408
6076 Ga0316574_0001237
6077 Ga0316574_0002061
6078 Ga0316574_0002774
6079 Ga0316574_0003400
6080 Ga0316574_0004897
6081 Ga0316574_0007877
6082 Ga0316574_0008156
6083 Ga0316574_0008451
6084 Ga0316574_0009404
6085 Ga0316574_0011243
6086 Ga0316574_0012365
6087 Ga0316574_0013285
6088 Ga0316574_0023925
6089 Ga0316574_0025396
6090 Ga0373924_0000261
6091 Ga0373924_0004834
6092 Ga0373924_0025824
6093 Ga0373931_0000192
6094 Ga0373931_0007206
6095 Ga0373931_0032438
6096 Ga0373935_0000266
6097 Ga0373935_0021624
6098 Ga0373935_0050330
6099 Ga0373927_0002028
6100 Ga0373927_0002186
6101 Ga0373927_0003649
6102 Ga0373933_0000012
6103 Ga0373933_0001804
6104 Ga0373933_0010050
6105 Ga0373933_0023074
6106 Ga0373947_0000053
6107 Ga0373947_0000704
6108 Ga0373937_0000040
6109 Ga0373937_0000685
6110 Ga0373937_0001899
6111 Ga0373937_0004958
6112 Ga0373937_0007722
6113 Ga0373937_0009223
6114 Ga0373937_0010019
6115 Ga0373937_0013178
6116 Ga0373937_0014507
6117 Ga0373937_0020451
6118 Ga0373937_0033402
6119 Ga0373937_0050863
6120 Ga0373937_0078348
6121 Ga0373937_0091110
6122 Ga0316582_0000548
6123 Ga0316582_0008882
6124 Ga0316582_0009642
6125 Ga0316582_0011171
6126 Ga0316582_0014073
6127 Ga0316582_0018498
6128 Ga0316582_0019393
6129 Ga0316582_0025753
6130 Ga0316582_0043629
6131 Ga0316582_0055826
6132 Ga0316584_0000749
6133 Ga0316584_0000755
6134 Ga0316584_0000832
6135 Ga0316584_0005608
6136 Ga0316584_0007008
6137 Ga0316584_0008804
6138 Ga0316584_0009852
6139 Ga0316584_0010382
6140 Ga0316584_0013609
6141 Ga0316584_0015760
6142 Ga0316584_0017874
6143 Ga0316584_0020998
6144 Ga0316584_0022038
6145 Ga0316584_0022969
6146 Ga0316584_0023711
6147 Ga0316584_0032206
6148 Ga0316584_0034203
6149 Ga0316584_0047424
6150 Ga0316584_0088996
6151 Ga0373925_0000224
6152 Ga0373925_0003979
6153 Ga0373925_0005709
6154 Ga0373925_0014955
6155 Ga0373925_0059001
6156 Ga0395899_0000002
6157 Ga0395899_0000038
6158 Ga0395899_0000153
6159 Ga0395899_0005101
6160 Ga0395899_0010062
6161 Ga0395899_0012721
6162 Ga0395899_0013361
6163 Ga0395900_0000030
6164 Ga0395900_0000166
6165 Ga0395900_0003714
6166 Ga0395900_0005356
6167 Ga0395900_0007219
6168 Ga0395900_0007813
6169 Ga0395900_0024217
6170 Ga0395900_0027495
6171 Ga0395900_0042705
6172 Ga0395900_0050525
6173 Ga0395900_0157747
6174 Ga0395898_0000238
6175 Ga0395898_0000637
6176 Ga0395898_0001413
6177 Ga0395898_0001576
6178 Ga0395898_0001776
6179 Ga0395898_0005657
6180 Ga0395898_0005929
6181 Ga0395898_0011263
6182 Ga0395898_0016701
6183 Ga0395898_0045149
6184 Ga0395898_0060525
6185 Ga0395898_0065611
6186 Ga0395898_0075738
6187 Ga0395898_0083014
6188 Ga0395898_0096553
6189 Ga0395905_0000279
6190 Ga0395905_0001877
6191 Ga0395905_0010974
6192 Ga0395905_0019865
6193 Ga0395905_0044136
6194 Ga0395905_0049792
6195 Ga0395905_0062487
6196 Ga0395905_0076152
6197 Ga0395905_0140554
6198 Ga0395905_0140914
6199 Ga0316581_0001090
6200 Ga0316581_0003198
6201 Ga0436364_0128024
6202 Ga0436364_0273345
6203 Ga0436364_0748068
6204 Ga0436364_0948471
6205 Ga0436364_1025760
6206 Ga0436364_1087122
6207 Ga0436364_1407139
6208 Ga0395901_0004789
6209 Ga0395901_0005421
6210 Ga0395901_0017151
6211 Ga0395901_0021920
6212 Ga0395901_0025360
6213 Ga0395901_0030126
6214 Ga0395901_0039945
6215 Ga0395901_0073610
6216 Ga0395901_0097369
6217 Ga0237819_00233
6218 Ga0400484_17439
6219 Ga0400484_25352
6220 Ga0400484_28409
6221 Ga0400484_37293
6222 Ga0400490_00800
6223 Ga0400490_23936
6224 Ga0400490_28306
6225 Ga0400490_36327
6226 Ga0400490_41017
6227 Ga0400490_59028
6228 Ga0400491_20122
6229 Ga0400485_01479
6230 Ga0400485_15364
6231 Ga0400485_20818
6232 Ga0400485_21241
6233 Ga0400488_00498
6234 Ga0400488_28224
6235 Ga0400488_47383
6236 Ga0400488_53689
6237 Ga0400488_62492
6238 Ga0400486_04655
6239 Ga0400486_09341
6240 Ga0400486_09905
6241 Ga0400486_10140
6242 Ga0400486_11090
6243 Ga0400486_24636
6244 Ga0400483_032108
6245 Ga0400483_037918
6246 Ga0400483_040188
6247 Ga0400483_052816
6248 Ga0400483_067684
6249 Ga0400483_075863
6250 Ga0400483_113365
6251 Ga0400483_122822
6252 Ga0400483_145205
6253 Ga0400483_152793
6254 Ga0400483_155166
6255 Ga0400483_157229
6256 Ga0400483_192989
6257 Ga0400483_196159
6258 Ga0400483_213256
6259 Ga0400483_213432
6260 Ga0400483_252458
6261 Ga0400489_28607
6262 Ga0400489_46762
6263 Ga0400489_73587
6264 Ga0400489_80143
6265 Ga0400489_85534
6266 Ga0400487_14846
6267 Ga0400487_19245
6268 Ga0400487_27138
6269 Ga0400487_27990
6270 Ga0400487_41902
6271 Ga0400487_62511
6272 Ga0436365_0427175
6273 Ga0436365_0682371
6274 Ga0436365_0796873
6275 Ga0436365_0837091
6276 Ga0436365_1226289
6277 Ga0436365_1313651
6278 Ga0436360_1375098
6279 Ga0436361_0011167
6280 Ga0436361_0037688
6281 Ga0436361_0046151
6282 Ga0436361_0067750
6283 Ga0436361_0113272
6284 Ga0436361_0163583
6285 Ga0436361_0212642
6286 Ga0436361_0226365
6287 Ga0436361_0238581
6288 Ga0436361_0374490
6289 Ga0436361_0439945
6290 Ga0436361_0504916
6291 Ga0436361_0563398
6292 Ga0436361_0571302
6293 Ga0436361_0572581
6294 Ga0436361_0585306
6295 Ga0436361_0621878
6296 Ga0436361_1011630
6297 Ga0436361_1119934
6298 Ga0436363_0113379
6299 Ga0436363_0663159
6300 Ga0436362_0281836
6301 Ga0436362_0691671
6302 Ga0436362_1132636
6303 Ga0439436_0000007
6304 Ga0439438_001673
6305 Ga0439439_0002229
6306 Ga0439466_0000451
6307 Ga0439466_0002572
6308 Ga0451797_0504496
6309 Ga0451807_0543831
6310 Ga0451833_0316743
6311 Ga0451849_1124712
6312 Ga0451853_0508974
6313 Ga0451853_0592879
6314 Ga0439433_0001073
6315 Ga0439448_0001885
6316 Ga0439448_0011958
6317 Ga0439432_001665
6318 Ga0439449_0000048
6319 Ga0439449_0000368
6320 Ga0439452_000081
6321 Ga0439463_009869
6322 Ga0450911_000488
6323 Ga0450894_000203
6324 Ga0450898_000240
6325 Ga0450903_000737
6326 Ga0450905_000574
6327 Ga0450906_000446
6328 Ga0450908_000082
6329 Ga0450908_004764
6330 Ga0450909_000554
6331 Ga0439459_0001107
6332 Ga0450918_002789
6333 Ga0451577_0000058
6334 Ga0451577_0000088
6335 Ga0451577_0001017
6336 Ga0451577_0001428
6337 Ga0451577_0001853
6338 Ga0451577_0002260
6339 Ga0451577_0002558
6340 Ga0451577_0003244
6341 Ga0451577_0003348
6342 Ga0451577_0006299
6343 Ga0451577_0006640
6344 Ga0451577_0006814
6345 Ga0451577_0007375
6346 Ga0451577_0007445
6347 Ga0451577_0011435
6348 Ga0451577_0011909
6349 Ga0451577_0012031
6350 Ga0451577_0015174
6351 Ga0451577_0015803
6352 Ga0451577_0041117
6353 Ga0451577_0055139
6354 Ga0451577_0056319
6355 Ga0466969_0002066
6356 Ga0466969_0002259
6357 Ga0466969_0003221
6358 Ga0466969_0015334
6359 Ga0466969_0029729
6360 Ga0466972_0002696
6361 Ga0466972_0004557
6362 Ga0466972_0006500
6363 Ga0466972_0006992
6364 Ga0453683_0000202
6365 Ga0453683_0002516
6366 Ga0453683_0002933
6367 Ga0453683_0003002
6368 Ga0453683_0006351
6369 Ga0453683_0010946
6370 Ga0453683_0014896
6371 Ga0453683_0028218
6372 Ga0453683_0053520
6373 Ga0466965_0000672
6374 Ga0466965_0001462
6375 Ga0466965_0002745
6376 Ga0466965_0012690
6377 Ga0466965_0040028
6378 Ga0466966_0001303
6379 Ga0466966_0002484
6380 Ga0466966_0005917
6381 Ga0466966_0007719
6382 Ga0466966_0008870
6383 Ga0466966_0026812
6384 Ga0466966_0034131
6385 Ga0466966_0045359
6386 Ga0466966_0053314
6387 Ga0466961_0000032
6388 Ga0466961_0000114
6389 Ga0466961_0002711
6390 Ga0466961_0009884
6391 Ga0466961_0011538
6392 Ga0466961_0013721
6393 Ga0466961_0048499
6394 Ga0466963_0000083
6395 Ga0466963_0000698
6396 Ga0466963_0000833
6397 Ga0466963_0002989
6398 Ga0466963_0004900
6399 Ga0466963_0023735
6400 Ga0466963_0023943
6401 Ga0466963_0025689
6402 Ga0466963_0030502
6403 Ga0466963_0047961
6404 Ga0466963_0089840
6405 Ga0466964_0012399
6406 Ga0453684_0000023
6407 Ga0453684_0000035
6408 Ga0453684_0000117
6409 Ga0453684_0000122
6410 Ga0453684_0000123
6411 Ga0453684_0000309
6412 Ga0453684_0001316
6413 Ga0453684_0001369
6414 Ga0453684_0001573
6415 Ga0453684_0001689
6416 Ga0453684_0002899
6417 Ga0453684_0003095
6418 Ga0453684_0003174
6419 Ga0453684_0003781
6420 Ga0453684_0004095
6421 Ga0453684_0004998
6422 Ga0453684_0005133
6423 Ga0453684_0005764
6424 Ga0453684_0009058
6425 Ga0453684_0010772
6426 Ga0453684_0011197
6427 Ga0453684_0013863
6428 Ga0453684_0014164
6429 Ga0453684_0018333
6430 Ga0453684_0018763
6431 Ga0453684_0026704
6432 Ga0453684_0027549
6433 Ga0453684_0027559
6434 Ga0453684_0038203
6435 Ga0453684_0039873
6436 Ga0453684_0041187
6437 Ga0453684_0056412
6438 Ga0453684_0060551
6439 Ga0453684_0063084
6440 Ga0453684_0068279
6441 Ga0453684_0083148
6442 Ga0453684_0206038
6443 Ga0466971_0000832
6444 Ga0466971_0001539
6445 Ga0466968_0001217
6446 Ga0466970_0000056
6447 Ga0466970_0000190
6448 Ga0466970_0014824
6449 Ga0466970_0031555
6450 Ga0466957_0000029
6451 Ga0466957_0000407
6452 Ga0466957_0007421
6453 Ga0466957_0010563
6454 Ga0466957_0021238
6455 Ga0466957_0028457
6456 Ga0466957_0039297
6457 Ga0466960_0000453
6458 Ga0466960_0004303
6459 Ga0466960_0006063
6460 Ga0466960_0008068
6461 Ga0466960_0013847
6462 Ga0466959_0005553
6463 Ga0466959_0011309
6464 Ga0466959_0037859
6465 Ga0466959_0038615
6466 Ga0466959_0048245
6467 Ga0466959_0049819
6468 Ga0466959_0052798
6469 Ga0451576_0000022
6470 Ga0451576_0000231
6471 Ga0451576_0000364
6472 Ga0451576_0000464
6473 Ga0451576_0000775
6474 Ga0451576_0001259
6475 Ga0451576_0004497
6476 Ga0451576_0005882
6477 Ga0451576_0029228
6478 Ga0451576_0043379
6479 Ga0451576_0084655
6480 Ga0466958_0000232
6481 Ga0466958_0000321
6482 Ga0466958_0002855
6483 Ga0466958_0010024
6484 Ga0466958_0011084
6485 Ga0466958_0012062
6486 Ga0466958_0014677
6487 Ga0466958_0046195
6488 Ga0466958_0052628
6489 Ga0466967_0000677
6490 Ga0466967_0004268
6491 Ga0466967_0006969
6492 Ga0466967_0007899
6493 Ga0466967_0011243
6494 Ga0466967_0011765
6495 Ga0466967_0013154
6496 Ga0466967_0022096
6497 Ga0466967_0024180
6498 Ga0466967_0026234
6499 Ga0466967_0031166
6500 Ga0466967_0047489
6501 Ga0466967_0052125
6502 Ga0466967_0065863
6503 Ga0466967_0069521
6504 Ga0466967_0069827
6505 Ga0495617_000020
6506 Ga0495617_000045
6507 Ga0495627_000001
6508 Ga0495627_000101
6509 Ga0495627_001944
6510 Ga0495627_003778
6511 Ga0495592_0000106
6512 Ga0495592_0010969
6513 Ga0495592_0023643
6514 Ga0495592_0027876
6515 Ga0495603_0000505
6516 Ga0495603_0003164
6517 Ga0495590_0007486
6518 Ga0495591_000032
6519 Ga0495591_000082
6520 Ga0495591_000120
6521 Ga0495591_008617
6522 Ga0495591_011910
6523 Ga0495629_0000168
6524 Ga0495629_0003590
6525 Ga0495629_0005629
6526 Ga0495629_0076458
6527 Ga0495638_0000449
6528 Ga0495638_0001787
6529 Ga0495638_0012733
6530 Ga0495638_0015895
6531 Ga0495638_0052042
6532 Ga0495641_0001114
6533 Ga0495651_0000040
6534 Ga0495651_0000281
6535 Ga0495651_0006326
6536 Ga0495651_0011493
6537 Ga0495651_0032621
6538 Ga0495651_0037277
6539 Ga0495651_0052301
6540 Ga0495653_0000051
6541 Ga0495653_0000082
6542 Ga0495653_0001238
6543 Ga0495653_0009937
6544 Ga0495653_0012929
6545 Ga0495653_0022514
6546 Ga0495653_0043857
6547 Ga0495653_0048483
6548 Ga0495653_0069040
6549 Ga0495650_0000015
6550 Ga0495650_0000069
6551 Ga0495650_0000108
6552 Ga0495650_0000462
6553 Ga0495650_0005553
6554 Ga0495650_0013749
6555 Ga0495580_0002009
6556 Ga0495580_0002656
6557 Ga0495580_0007903
6558 Ga0495580_0010389
6559 Ga0495580_0051366
6560 Ga0495582_0003038
6561 Ga0495582_0040044
6562 Ga0495605_0000029
6563 Ga0495605_0000147
6564 Ga0495605_0002910
6565 Ga0495605_0004096
6566 Ga0495605_0005387
6567 Ga0495605_0008491
6568 Ga0495605_0009688
6569 Ga0495605_0017022
6570 Ga0495605_0019718
6571 Ga0495605_0022992
6572 Ga0495639_0000001
6573 Ga0495662_0000636
6574 Ga0495662_0008955
6575 Ga0495664_0001541
6576 Ga0495664_0004460
6577 Ga0495664_0011970
6578 Ga0495664_0021437
6579 Ga0495664_0059566
6580 Ga0495584_0000033
6581 Ga0495584_0000052
6582 Ga0495584_0000270
6583 Ga0495584_0032132
6584 Ga0495585_0000003
6585 Ga0495585_0000016
6586 Ga0495585_0000049
6587 Ga0495585_0000075
6588 Ga0495585_0000424
6589 Ga0495585_0003440
6590 Ga0495585_0003811
6591 Ga0495585_0013500
6592 Ga0495585_0020891
6593 Ga0495594_0041239
6594 Ga0495596_0000019
6595 Ga0495596_0000371
6596 Ga0495596_0000640
6597 Ga0495607_0000019
6598 Ga0495607_0002702
6599 Ga0495607_0003555
6600 Ga0495607_0004167
6601 Ga0495607_0006134
6602 Ga0495607_0006425
6603 Ga0495607_0014459
6604 Ga0495583_0000057
6605 Ga0495583_0000169
6606 Ga0495583_0000173
6607 Ga0495583_0000625
6608 Ga0495583_0000932
6609 Ga0495583_0004929
6610 Ga0495583_0005767
6611 Ga0495583_0014158
6612 Ga0495583_0015459
6613 Ga0495583_0015660
6614 Ga0495606_0000161
6615 Ga0495606_0000555
6616 Ga0495606_0000600
6617 Ga0495606_0000676
6618 Ga0495606_0000709
6619 Ga0495606_0000806
6620 Ga0495606_0001735
6621 Ga0495606_0004479
6622 Ga0495606_0006881
6623 Ga0495606_0007103
6624 Ga0495606_0007373
6625 Ga0495606_0008931
6626 Ga0495606_0009833
6627 Ga0495606_0012781
6628 Ga0495606_0014135
6629 Ga0495606_0021425
6630 Ga0495606_0033496
6631 Ga0495608_0000044
6632 Ga0495608_0001258
6633 Ga0495608_0016431
6634 Ga0495608_0019750
6635 Ga0495608_0035148
6636 Ga0495610_0000014
6637 Ga0495610_0000128
6638 Ga0495610_0000133
6639 Ga0495610_0000927
6640 Ga0495610_0005388
6641 Ga0495616_0000054
6642 Ga0495616_0000260
6643 Ga0495616_0000684
6644 Ga0495616_0000734
6645 Ga0495616_0001757
6646 Ga0495616_0004524
6647 Ga0495616_0004535
6648 Ga0495616_0007477
6649 Ga0495616_0009188
6650 Ga0495618_0032188
6651 Ga0495618_0065507
6652 Ga0495620_0000059
6653 Ga0495620_0000127
6654 Ga0495620_0001048
6655 Ga0495620_0005030
6656 Ga0495620_0016425
6657 Ga0495628_0000439
6658 Ga0495628_0000450
6659 Ga0495628_0017521
6660 Ga0495628_0062079
6661 Ga0495631_0000013
6662 Ga0495631_0020966
6663 Ga0495631_0023566
6664 Ga0495632_0000579
6665 Ga0495632_0000907
6666 Ga0495632_0002535
6667 Ga0495632_0011838
6668 Ga0495632_0014668
6669 Ga0495632_0018525
6670 Ga0495637_0000006
6671 Ga0495637_0006007
6672 Ga0495637_0021474
6673 Ga0495643_0000087
6674 Ga0495643_0000396
6675 Ga0495643_0000406
6676 Ga0495643_0000882
6677 Ga0495643_0001250
6678 Ga0495643_0003954
6679 Ga0495643_0005166
6680 Ga0495643_0010932
6681 Ga0495644_0003040
6682 Ga0495644_0005363
6683 Ga0495644_0008014
6684 Ga0495648_0000011
6685 Ga0495648_0000104
6686 Ga0495648_0000392
6687 Ga0495648_0000734
6688 Ga0495648_0001013
6689 Ga0495648_0001083
6690 Ga0495648_0002586
6691 Ga0495648_0003040
6692 Ga0495648_0006050
6693 Ga0495648_0006649
6694 Ga0495648_0011427
6695 Ga0495648_0019209
6696 Ga0495648_0030330
6697 Ga0495648_0030477
6698 Ga0495666_0009547
6699 Ga0495666_0012871
6700 Ga0495642_0000305
6701 Ga0495642_0002022
6702 Ga0495642_0011985
6703 Ga0495652_0001063
6704 Ga0495652_0001238
6705 Ga0495652_0001868
6706 Ga0495652_0013586
6707 Ga0495652_0018196
6708 Ga0495652_0037557
6709 Ga0495652_0076051
6710 Ga0495654_0000104
6711 Ga0495654_0001192
6712 Ga0495654_0003890
6713 Ga0495654_0004007
6714 Ga0495654_0012609
6715 Ga0495665_0012811
6716 Ga0495665_0038416
6717 Ga0495640_0015569
6718 Ga0495640_0026789
6719 Ga0495640_0029076
6720 Ga0495640_0032788
6721 Ga0495640_0042822
6722 Ga0495586_0011917
6723 Ga0495587_0000046
6724 Ga0495587_0000591
6725 Ga0495587_0007916
6726 Ga0495587_0009821
6727 Ga0495587_0029886
6728 Ga0495609_0000345
6729 Ga0495609_0000879
6730 Ga0495609_0001219
6731 Ga0495609_0001815
6732 Ga0495609_0027959
6733 Ga0495597_0000965
6734 Ga0495597_0000986
6735 Ga0495645_0038587
6736 Ga0495645_0073304
6737 Ga0495622_0000034
6738 Ga0495622_0000047
6739 Ga0495622_0000181
6740 Ga0495622_0009809
6741 Ga0495633_0000304
6742 Ga0495633_0000597
6743 Ga0495633_0001240
6744 Ga0495633_0002356
6745 Ga0495633_0008225
6746 Ga0495667_0000518
6747 Ga0495667_0001587
6748 Ga0495667_0016517
6749 Ga0495667_0035156
6750 Ga0495667_0039111
6751 Ga0495656_0000520
6752 Ga0495656_0013401
6753 Ga0495656_0015951
6754 Ga0495668_0000579
6755 Ga0495668_0001185
6756 Ga0495668_0001336
6757 Ga0495668_0001366
6758 Ga0495668_0002315
6759 Ga0495668_0006131
6760 Ga0495668_0008541
6761 Ga0495668_0010871
6762 Ga0495668_0011480
6763 Ga0495668_0016706
6764 Ga0495668_0035526
6765 Ga0495668_0040493
6766 Ga0495634_0003764
6767 Ga0495634_0004939
6768 Ga0495634_0011887
6769 Ga0495634_0030669
6770 Ga0495611_0000024
6771 Ga0495611_0000613
6772 Ga0495611_0013752
6773 Ga0495625_0000103
6774 Ga0495625_0000615
6775 Ga0495625_0002403
6776 Ga0495625_0011359
6777 Ga0495625_0017857
6778 Ga0495625_0021370
6779 Ga0495625_0062942
6780 Ga0495635_0000499
6781 Ga0495635_0002467
6782 Ga0495635_0007327
6783 Ga0495635_0015679
6784 Ga0495635_0038692
6785 Ga0495659_0000507
6786 Ga0495659_0006904
6787 Ga0495661_0000508
6788 Ga0495661_0003743
6789 Ga0495661_0004508
6790 Ga0495661_0011425
6791 Ga0495661_0027671
6792 Ga0495588_0003821
6793 Ga0495657_0000547
6794 Ga0495657_0001713
6795 Ga0495657_0014998
6796 Ga0495657_0015382
6797 Ga0495657_0024698
6798 Ga0495657_0027870
6799 Ga0495657_0028717
6800 Ga0495657_0067075
6801 Ga0495599_0001467
6802 Ga0495599_0044444
6803 Ga0495599_0050542
6804 Ga0495623_0002970
6805 Ga0495623_0019420
6806 Ga0495623_0027732
6807 Ga0495623_0033370
6808 Ga0495646_0005997
6809 Ga0495646_0006642
6810 Ga0495646_0028721
6811 Ga0495646_0035084
6812 Ga0495646_0042584
6813 Ga0495658_0003975
6814 Ga0495669_0001613
6815 Ga0495669_0008442
6816 Ga0495613_0000311
6817 Ga0495613_0009170
6818 Ga0495613_0031726
6819 Ga0495613_0044701
6820 Ga0495613_0063955
6821 Ga0495624_0000172
6822 Ga0495624_0014596
6823 Ga0495624_0034753
6824 Ga0495670_0000020
6825 Ga0495670_0000089
6826 Ga0495670_0001902
6827 Ga0495671_0000005
6828 Ga0495671_0000034
6829 Ga0495671_0000788
6830 Ga0495671_0014991
6831 Ga0495649_0000140
6832 Ga0495649_0000511
6833 Ga0495649_0000655
6834 Ga0495649_0000890
6835 Ga0495649_0000932
6836 Ga0495649_0001761
6837 Ga0495649_0002309
6838 Ga0495649_0010831
6839 Ga0495649_0012790
6840 Ga0495649_0014064
6841 Ga0495649_0019593
6842 Ga0495649_0027043
6843 Ga0495589_0000170
6844 Ga0495589_0000404
6845 Ga0495589_0002333
6846 Ga0495589_0004544
6847 Ga0495589_0007104
6848 Ga0495600_0002404
6849 Ga0495600_0005116
6850 Ga0495600_0017162
6851 Ga0495600_0044179
6852 Ga0495600_0045316
6853 Ga0495660_0000127
6854 Ga0495660_0000372
6855 Ga0495660_0004162
6856 Ga0495660_0008310
6857 Ga0495660_0009316
6858 Ga0495660_0021275
6859 Ga0495660_0028490
6860 Ga0495660_0030508
6861 Ga0495581_0012327
6862 Ga0495604_0000049
6863 Ga0495604_0002863
6864 Ga0495604_0003848
6865 Ga0495604_0004754
6866 Ga0495604_0010087
6867 Ga0495604_0052012
6868 Ga0495636_0000216
6869 Ga0495636_0003297
6870 Ga0495674_0000020
6871 Ga0495674_0001538
6872 Ga0495674_0001845
6873 Ga0495674_0001880
6874 Ga0495674_0022761
6875 Ga0495674_0024333
6876 Ga0495674_0033954
6877 Ga0495674_0069561
6878 Ga0495674_0082203
6879 Ga0495672_0000013
6880 Ga0495672_0000174
6881 Ga0495672_0000530
6882 Ga0495672_0000648
6883 Ga0495672_0002584
6884 Ga0495672_0005425
6885 Ga0495672_0006208
6886 Ga0495672_0013647
6887 Ga0495672_0014521
6888 Ga0495672_0022835
6889 Ga0495676_0000058
6890 Ga0495676_0012393
6891 Ga0495676_0024197
6892 Ga0495676_0028024
6893 Ga0495676_0085445
6894 Ga0495680_0000977
6895 Ga0495680_0003381
6896 Ga0495680_0005627
6897 Ga0495680_0010275
6898 Ga0495680_0010996
6899 Ga0495680_0011914
6900 Ga0495680_0016012
6901 Ga0495680_0018084
6902 Ga0495680_0022696
6903 Ga0495680_0025246
6904 Ga0495680_0049640
6905 Ga0495683_0000006
6906 Ga0495683_0000007
6907 Ga0495683_0000181
6908 Ga0495683_0000594
6909 Ga0495683_0001052
6910 Ga0495683_0009884
6911 Ga0495683_0014253
6912 Ga0495683_0017841
6913 Ga0495683_0033338
6914 Ga0495687_000004
6915 Ga0495687_000103
6916 Ga0495687_000797
6917 Ga0495687_001002
6918 Ga0495675_0000062
6919 Ga0495675_0000155
6920 Ga0495675_0008068
6921 Ga0495675_0017580
6922 Ga0495675_0022730
6923 Ga0495675_0024920
6924 Ga0495679_000008
6925 Ga0495679_000555
6926 Ga0495679_000612
6927 Ga0495679_001722
6928 Ga0495679_006187
6929 Ga0495685_000006
6930 Ga0495673_0000009
6931 Ga0495673_0000013
6932 Ga0495673_0001734
6933 Ga0495673_0002039
6934 Ga0495673_0005017
6935 Ga0495681_0000231
6936 Ga0495681_0000655
6937 Ga0495681_0001456
6938 Ga0495681_0003068
6939 Ga0495681_0003977
6940 Ga0495681_0005691
6941 Ga0495681_0015678
6942 Ga0495684_0001474
6943 Ga0495684_0005106
6944 Ga0495684_0010906
6945 Ga0495684_0013571
6946 Ga0495684_0026050
6947 Ga0495684_0027848
6948 Ga0495684_0055832
6949 Ga0495686_0000008
6950 Ga0495686_0000140
6951 Ga0495686_0000266
6952 Ga0495686_0002955
6953 Ga0495686_0006716
6954 Ga0495686_0008786
6955 Ga0495686_0015818
6956 Ga0495686_0020788
6957 Ga0495686_0021963
6958 Ga0495686_0080760
6959 Ga0495593_0000492
6960 Ga0495593_0002655
6961 Ga0495593_0011188
6962 Ga0495593_0011838
6963 Ga0495593_0019333
6964 Ga0495602_0000558
6965 Ga0495602_0000750
6966 Ga0495602_0004231
6967 Ga0495602_0010916
6968 Ga0495602_0013660
6969 Ga0495602_0028661
6970 Ga0495602_0043688
6971 Ga0495602_0100264
6972 Ga0495614_0009874
6973 Ga0495614_0037464
6974 Ga0495615_0000035
6975 Ga0495626_0000025
6976 Ga0495626_0000097
6977 Ga0495626_0000479
6978 Ga0495626_0000531
6979 Ga0495626_0001572
6980 Ga0495626_0016297
6981 Ga0495626_0023530
6982 Ga0496100_0002705
6983 Ga0496100_0020728
6984 Ga0496100_0022455
6985 Ga0496100_0040746
6986 Ga0496101_0000074
6987 Ga0496101_0000375
6988 Ga0496101_0006659
6989 Ga0496101_0006671
6990 Ga0496101_0036313
6991 Ga0496101_0039423
6992 Ga0496101_0053503
6993 Ga0496101_0079730
6994 Ga0496102_0000015
6995 Ga0496102_0000891
6996 Ga0496102_0001730
6997 Ga0496102_0002503
6998 Ga0496102_0006621
6999 Ga0496102_0009367
7000 Ga0496102_0012819
7001 Ga0496102_0017696
7002 Ga0496102_0026802
7003 Ga0496102_0029055
7004 Ga0496102_0031159
7005 Ga0496102_0042322
7006 Ga0496102_0052166
7007 Ga0496102_0059033
7008 Ga0496102_0072352
7009 Ga0496102_0125846
7010 Ga0496103_0000020
7011 Ga0496103_0000084
7012 Ga0496103_0000866
7013 Ga0496103_0002826
7014 Ga0496103_0010227
7015 Ga0496103_0027890
7016 Ga0496103_0029152
7017 Ga0496104_0000165
7018 Ga0496104_0007065
7019 Ga0496104_0011663
7020 Ga0496104_0019504
7021 Ga0496104_0023136
7022 Ga0496104_0029164
7023 Ga0496104_0036140
7024 Ga0496104_0039290
7025 Ga0496104_0052479
7026 Ga0496105_0001670
7027 Ga0496105_0005065
7028 Ga0496105_0006606
7029 Ga0496105_0009075
7030 Ga0496105_0017774
7031 Ga0496105_0022147
7032 Ga0496105_0046663
7033 Ga0496105_0050742
7034 Ga0496106_0000075
7035 Ga0496106_0000960
7036 Ga0496106_0003049
7037 Ga0496106_0007594
7038 Ga0496106_0010201
7039 Ga0496106_0025825
7040 Ga0496106_0031424
7041 Ga0496106_0035097
7042 Ga0496106_0044721
7043 Ga0496107_0001771
7044 Ga0496107_0009639
7045 Ga0496107_0020479
7046 Ga0496107_0030509
7047 Ga0496107_0062004
7048 Ga0496107_0081289
7049 Ga0496107_0101933
7050 Ga0496108_0000003
7051 Ga0496108_0000534
7052 Ga0496108_0005091
7053 Ga0496108_0026087
7054 Ga0496108_0043966
7055 Ga0496109_0000820
7056 Ga0496109_0002591
7057 Ga0496109_0002738
7058 Ga0496109_0025719
7059 Ga0496109_0027212
7060 Ga0496109_0033194
7061 Ga0496109_0038943
7062 Ga0496109_0043791
7063 Ga0496109_0074022
7064 Ga0496109_0171041
7065 Ga0496110_0000374
7066 Ga0496110_0003347
7067 Ga0496110_0006293
7068 Ga0496110_0006355
7069 Ga0496110_0014733
7070 Ga0496110_0021566
7071 Ga0496110_0028434
7072 Ga0496110_0046471
7073 Ga0496110_0052360
7074 Ga0496110_0074456
7075 Ga0496111_0006277
7076 Ga0496111_0009479
7077 Ga0496111_0020535
7078 Ga0496111_0053027
7079 Ga0496112_0010375
7080 Ga0496112_0022446
7081 Ga0496112_0023925
7082 Ga0496113_0012154
7083 Ga0496113_0016217
7084 Ga0496113_0016757
7085 Ga0496113_0017906
7086 Ga0496113_0018517
7087 Ga0496114_0000455
7088 Ga0496114_0000817
7089 Ga0496114_0003071
7090 Ga0496114_0003887
7091 Ga0496114_0006067
7092 Ga0496114_0007202
7093 Ga0496114_0013508
7094 Ga0496114_0017272
7095 Ga0496114_0022580
7096 Ga0496114_0024244
7097 Ga0496114_0025467
7098 Ga0496114_0030606
7099 Ga0496114_0031744
7100 Ga0496115_0000013
7101 Ga0496115_0000033
7102 Ga0496115_0000234
7103 Ga0496115_0005234
7104 Ga0496115_0009074
7105 Ga0496115_0013662
7106 Ga0496115_0026308
7107 Ga0496115_0037996
7108 Ga0496115_0038523
7109 Ga0496116_0000099
7110 Ga0496116_0000139
7111 Ga0496116_0000255
7112 Ga0496116_0002999
7113 Ga0496116_0005991
7114 Ga0496116_0007951
7115 Ga0496117_0000047
7116 Ga0496117_0000123
7117 Ga0496117_0000475
7118 Ga0496117_0000851
7119 Ga0496117_0001510
7120 Ga0496117_0004831
7121 Ga0496117_0015243
7122 Ga0496117_0039234
7123 Ga0496117_0047987
7124 Ga0496117_0048851
7125 Ga0496117_0069437
7126 Ga0496118_0000050
7127 Ga0496118_0000180
7128 Ga0496118_0000482
7129 Ga0496118_0001956
7130 Ga0496118_0002472
7131 Ga0496118_0003946
7132 Ga0496118_0004382
7133 Ga0496118_0010557
7134 Ga0496118_0015887
7135 Ga0496118_0032782
7136 Ga0496118_0042334
7137 Ga0496118_0046240
7138 Ga0496118_0066316
7139 Ga0496118_0102605
7140 Ga0496119_0000121
7141 Ga0496119_0001262
7142 Ga0496119_0001894
7143 Ga0496119_0002030
7144 Ga0496119_0004217
7145 Ga0496119_0006846
7146 Ga0496119_0029783
7147 Ga0496120_0000015
7148 Ga0496120_0002847
7149 Ga0496120_0003407
7150 Ga0496120_0011569
7151 Ga0496121_0000014
7152 Ga0496121_0000229
7153 Ga0496121_0000423
7154 Ga0496121_0000535
7155 Ga0496121_0000697
7156 Ga0496121_0001534
7157 Ga0496121_0002341
7158 Ga0496121_0002903
7159 Ga0496121_0003987
7160 Ga0496121_0004070
7161 Ga0496121_0004671
7162 Ga0496121_0006852
7163 Ga0496121_0028530
7164 Ga0496121_0031005
7165 Ga0496121_0033075
7166 Ga0496121_0046171
7167 Ga0496122_0000032
7168 Ga0496122_0000097
7169 Ga0496122_0000137
7170 Ga0496122_0000221
7171 Ga0496122_0000725
7172 Ga0496122_0001675
7173 Ga0496122_0003392
7174 Ga0496122_0004898
7175 Ga0496122_0007329
7176 Ga0496122_0009727
7177 Ga0496122_0011400
7178 Ga0496123_0000022
7179 Ga0496123_0000093
7180 Ga0496123_0000429
7181 Ga0496123_0000967
7182 Ga0496123_0000989
7183 Ga0496123_0002260
7184 Ga0496123_0003395
7185 Ga0496123_0003987
7186 Ga0496123_0005741
7187 Ga0496123_0007807
7188 Ga0496123_0008195
7189 Ga0496123_0008283
7190 Ga0496123_0020339
7191 Ga0496123_0059977
7192 Ga0496124_0000001
7193 Ga0496124_0000019
7194 Ga0496124_0000383
7195 Ga0496124_0000567
7196 Ga0496124_0000799
7197 Ga0496124_0001996
7198 Ga0496124_0002309
7199 Ga0496124_0003593
7200 Ga0496124_0003997
7201 Ga0496124_0006000
7202 Ga0496124_0007199
7203 Ga0496124_0008901
7204 Ga0496124_0020138
7205 Ga0496124_0021395
7206 Ga0496124_0032888
7207 Ga0496124_0049566
7208 Ga0496124_0058597
7209 Ga0496124_0058932
7210 Ga0496125_0000014
7211 Ga0496125_0000041
7212 Ga0496125_0000317
7213 Ga0496125_0001963
7214 Ga0496125_0003502
7215 Ga0496125_0006562
7216 Ga0496125_0008776
7217 Ga0496125_0013729
7218 Ga0496125_0028098
7219 Ga0496125_0064749
7220 Ga0496126_0000017
7221 Ga0496126_0000045
7222 Ga0496126_0000049
7223 Ga0496126_0000095
7224 Ga0496126_0000335
7225 Ga0496126_0000340
7226 Ga0496126_0003390
7227 Ga0496126_0004741
7228 Ga0496126_0007045
7229 Ga0496126_0012041
7230 Ga0496126_0012351
7231 Ga0496126_0015370
7232 Ga0496126_0016664
7233 Ga0496126_0024420
7234 Ga0496126_0074758
7235 Ga0496126_0101002
7236 Ga0495678_000056
7237 Ga0495678_000222
7238 Ga0495678_001846
7239 Ga0495678_001994
7240 Ga0495678_005108
7241 Ga0495678_008462
7242 Ga0495678_011186
7243 Ga0495678_014469
7244 Ga0495682_0000425
7245 Ga0495682_0007862
7246 Ga0495682_0022865
7247 Ga0501031_0000023
7248 Ga0501031_0002467
7249 Ga0501031_0005801
7250 Ga0501031_0031643
7251 Ga0501031_0065629
7252 Ga0501032_0000546
7253 Ga0501032_0001825
7254 Ga0501032_0004032
7255 Ga0501032_0005036
7256 Ga0501032_0006453
7257 Ga0501032_0008641
7258 Ga0501032_0018962
7259 Ga0501032_0019350
7260 Ga0501032_0022378
7261 Ga0501032_0039383
7262 Ga0501033_0000245
7263 Ga0501033_0001226
7264 Ga0501033_0001235
7265 Ga0501033_0004451
7266 Ga0501033_0007011
7267 Ga0501033_0011502
7268 Ga0501033_0012959
7269 Ga0501033_0044729
7270 Ga0501034_0000158
7271 Ga0501034_0000523
7272 Ga0501034_0001507
7273 Ga0501034_0002044
7274 Ga0501034_0002536
7275 Ga0501034_0002989
7276 Ga0501034_0003113
7277 Ga0501034_0008106
7278 Ga0501034_0008695
7279 Ga0501034_0011443
7280 Ga0501034_0014180
7281 Ga0501034_0022121
7282 Ga0501034_0030552
7283 Ga0501034_0032444
7284 Ga0501034_0041878
7285 Ga0501034_0052709
7286 Ga0501034_0069699
7287 Ga0501034_0075355
7288 Ga0501034_0089977
7289 Ga0501034_0100606
7290 Ga0501036_0000277
7291 Ga0501036_0001029
7292 Ga0501036_0048548
7293 Ga0501036_0059229
7294 Ga0501036_0070590
7295 Ga0501037_0000709
7296 Ga0501037_0000838
7297 Ga0501037_0001324
7298 Ga0501037_0008605
7299 Ga0501037_0010971
7300 Ga0501037_0033196
7301 Ga0501037_0035378
7302 Ga0501037_0055024
7303 Ga0501038_0000030
7304 Ga0501038_0002532
7305 Ga0501038_0005372
7306 Ga0501038_0007617
7307 Ga0501038_0012970
7308 Ga0501038_0031302
7309 Ga0501038_0032402
7310 Ga0501038_0032550
7311 Ga0501038_0037305
7312 Ga0501038_0040154
7313 Ga0501038_0046680
7314 Ga0501038_0082978
7315 Ga0501039_0000733
7316 Ga0501039_0001120
7317 Ga0501039_0001378
7318 Ga0501039_0002089
7319 Ga0501039_0038445
7320 Ga0501039_0047992
7321 Ga0501039_0075050
7322 Ga0501040_0041771
7323 Ga0501041_0006009
7324 Ga0501041_0032700
7325 Ga0501042_0004251
7326 Ga0501042_0004748
7327 Ga0501042_0008803
7328 Ga0501042_0022853
7329 Ga0501042_0027026
7330 Ga0501043_0000043
7331 Ga0501043_0001195
7332 Ga0501043_0001589
7333 Ga0501043_0001903
7334 Ga0501043_0002267
7335 Ga0501043_0003998
7336 Ga0501043_0006011
7337 Ga0501043_0008733
7338 Ga0501043_0018014
7339 Ga0501043_0026983
7340 Ga0501043_0031484
7341 Ga0501043_0059147
7342 Ga0501043_0060924
7343 Ga0501043_0064550
7344 Ga0501046_0000714
7345 Ga0501046_0007718
7346 Ga0501046_0011141
7347 Ga0501046_0060870
7348 Ga0501047_0000110
7349 Ga0501047_0000185
7350 Ga0501047_0001056
7351 Ga0501047_0007121
7352 Ga0501047_0008509
7353 Ga0501047_0009993
7354 Ga0501047_0010641
7355 Ga0501047_0010690
7356 Ga0501047_0026312
7357 Ga0501047_0031114
7358 Ga0501047_0039504
7359 Ga0501047_0080000
7360 Ga0501047_0100805
7361 Ga0501048_0000641
7362 Ga0501048_0000661
7363 Ga0501048_0014258
7364 Ga0501048_0014635
7365 Ga0501048_0028332
7366 Ga0501048_0046570
7367 Ga0501067_0000259
7368 Ga0501067_0000550
7369 Ga0501067_0013282
7370 Ga0501067_0015504
7371 Ga0501068_0001945
7372 Ga0501068_0006918
7373 Ga0501068_0024669
7374 Ga0501068_0026310
7375 Ga0501069_0000596
7376 Ga0501069_0009497
7377 Ga0501069_0054635
7378 Ga0501070_0000091
7379 Ga0501070_0002308
7380 Ga0501070_0003609
7381 Ga0501070_0006448
7382 Ga0501070_0006696
7383 Ga0501070_0008364
7384 Ga0501070_0011567
7385 Ga0501070_0020666
7386 Ga0501070_0023055
7387 Ga0501070_0023294
7388 Ga0501070_0023509
7389 Ga0501070_0025443
7390 Ga0501070_0050432
7391 Ga0501070_0054538
7392 Ga0501071_0006081
7393 Ga0501071_0006615
7394 Ga0501071_0008639
7395 Ga0501072_0000676
7396 Ga0501072_0003419
7397 Ga0501072_0012542
7398 Ga0501072_0064230
7399 Ga0501073_0000031
7400 Ga0501073_0001659
7401 Ga0501073_0003905
7402 Ga0501073_0011609
7403 Ga0501073_0016100
7404 Ga0501073_0016810
7405 Ga0501074_0000276
7406 Ga0501074_0002015
7407 Ga0501074_0002814
7408 Ga0501074_0006125
7409 Ga0501074_0008301
7410 Ga0501074_0016024
7411 Ga0501074_0022659
7412 Ga0501074_0025009
7413 Ga0501075_0000136
7414 Ga0501075_0008181
7415 Ga0501075_0053256
7416 Ga0501076_0000016
7417 Ga0501076_0018824
7418 Ga0501077_0000024
7419 Ga0501077_0001451
7420 Ga0501077_0006169
7421 Ga0501077_0014142
7422 Ga0501077_0044607
7423 Ga0501249_000066
7424 Ga0501249_000074
7425 Ga0501249_000186
7426 Ga0501257_000036
7427 Ga0501257_000673
7428 Ga0501229_001004
7429 Ga0501079_0003173
7430 Ga0501079_0014455
7431 Ga0501079_0037423
7432 Ga0501080_0001343
7433 Ga0501080_0008495
7434 Ga0501080_0011528
7435 Ga0501080_0034133
7436 Ga0501080_0040514
7437 Ga0501080_0047382
7438 Ga0501080_0068525
7439 Ga0501080_0117132
7440 Ga0501080_0142810
7441 Ga0501081_0013418
7442 Ga0501083_0000057
7443 Ga0501083_0000088
7444 Ga0501083_0004326
7445 Ga0501083_0004641
7446 Ga0501083_0004750
7447 Ga0501083_0009443
7448 Ga0501083_0028576
7449 Ga0501267_000733
7450 Ga0501269_000265
7451 Ga0501035_0000337
7452 Ga0501035_0000958
7453 Ga0501035_0002533
7454 Ga0501035_0004288
7455 Ga0501035_0005215
7456 Ga0501035_0007612
7457 Ga0501035_0011367
7458 Ga0501035_0015793
7459 Ga0501035_0023398
7460 Ga0501035_0024099
7461 Ga0501035_0112007
7462 Ga0501044_0000391
7463 Ga0501044_0000512
7464 Ga0501044_0000709
7465 Ga0501044_0001006
7466 Ga0501044_0001081
7467 Ga0501044_0001176
7468 Ga0501044_0004261
7469 Ga0501044_0004798
7470 Ga0501044_0004941
7471 Ga0501044_0007114
7472 Ga0501044_0009074
7473 Ga0501044_0011454
7474 Ga0501044_0015931
7475 Ga0501044_0017323
7476 Ga0501044_0024739
7477 Ga0501044_0033712
7478 Ga0501044_0034562
7479 Ga0501044_0042791
7480 Ga0501044_0059487
7481 Ga0501044_0061225
7482 Ga0501045_0043871
7483 Ga0501045_0053339
7484 Ga0501045_0055991
7485 Ga0501226_000004
7486 nmdc:mga03683_15374_c1
7487 nmdc:mga03n38_11035_c1
7488 nmdc:mga03n38_9259_c1
7489 nmdc:mga00v17_1632_c1
7490 nmdc:mga00v17_22530_c1
7491 nmdc:mga00v17_4815_c1
7492 nmdc:mga00v17_7785_c1
7493 nmdc:mga0yw44_21709_c1
7494 nmdc:mga0yw44_23124_c1
7495 nmdc:mga0yw44_28992_c1
7496 nmdc:mga0k408_3020_c1
7497 nmdc:mga0k408_30680_c1
7498 nmdc:mga06z11_2376_c1
7499 nmdc:mga06z11_71_c1
7500 nmdc:mga04h51_2946_c1
7501 nmdc:mga04h51_43_c1
7502 nmdc:mga07m45_15850_c1
7503 nmdc:mga07m45_29663_c1
7504 nmdc:mga07m45_430_c1
7505 nmdc:mga07m45_7175_c1
7506 nmdc:mga07m45_8479_c1
7507 nmdc:mga05p37_10776_c1
7508 nmdc:mga05p37_12100_c1
7509 nmdc:mga05p37_20283_c1
7510 nmdc:mga05p37_20331_c1
7511 nmdc:mga05p37_554_c1
7512 nmdc:mga05p37_58071_c1
7513 nmdc:mga05p37_58658_c1
7514 nmdc:mga05p37_7707_c2
7515 nmdc:mga05p37_86754_c1
7516 nmdc:mga09592_22742_c1
7517 nmdc:mga09592_3235_c1
7518 nmdc:mga0qj67_11041_c1
7519 nmdc:mga0qj67_12710_c1
7520 nmdc:mga0qj67_18005_c1
7521 nmdc:mga0qj67_25004_c1
7522 nmdc:mga0qj67_42190_c1
7523 nmdc:mga0qj67_4538_c1
7524 nmdc:mga0qj67_54504_c1
7525 nmdc:mga06r32_1170_c1
7526 nmdc:mga06r32_12640_c1
7527 nmdc:mga06r32_18698_c1
7528 nmdc:mga06r32_2159_c1
7529 nmdc:mga06r32_34493_c1
7530 nmdc:mga06r32_3851_c1
7531 nmdc:mga06r32_3933_c1
7532 nmdc:mga06r32_4999_c1
7533 nmdc:mga06r32_7572_c1
7534 nmdc:mga06r32_94114_c1
7535 nmdc:mga08y16_1_c1
7536 nmdc:mga08y16_2174_c1
7537 nmdc:mga08y16_34732_c1
7538 nmdc:mga08y16_36950_c1
7539 nmdc:mga08y16_46825_c1
7540 nmdc:mga08y16_4751_c1
7541 nmdc:mga08y16_52439_c1
7542 nmdc:mga08y16_85071_c1
7543 nmdc:mga0n895_125058_c1
7544 nmdc:mga0n895_14608_c1
7545 nmdc:mga0n895_62383_c1
7546 nmdc:mga0n895_71712_c1
7547 nmdc:mga0n895_83033_c1
7548 nmdc:mga0rr50_3091_c1
7549 nmdc:mga0rr50_9439_c1
7550 nmdc:mga0rr50_9522_c1
7551 nmdc:mga08x19_28115_c1
7552 nmdc:mga08x19_31257_c1
7553 nmdc:mga08x19_5112_c1
7554 nmdc:mga08x19_5799_c1
7555 nmdc:mga0a205_134234_c1
7556 nmdc:mga0a205_15133_c1
7557 nmdc:mga0a205_16070_c1
7558 nmdc:mga0a205_44381_c1
7559 nmdc:mga0a205_56383_c1
7560 Ga0495601_0001520
7561 Ga0495612_0013795
7562 Ga0500610_0020960
7563 Ga0500635_0000144
7564 Ga0500635_0005401
7565 Ga0495595_0002514
7566 Ga0495619_0007842
7567 Ga0495619_0010092
7568 Ga0495619_0060788
7569 Ga0500578_0016233
7570 Ga0500643_000003
7571 Ga0500643_002413
7572 Ga0500643_004785
7573 Ga0500643_005928
7574 Ga0500644_0000617
7575 Ga0500646_0002627
7576 Ga0500651_0001334
7577 Ga0500566_0000054
7578 Ga0500650_0006939
7579 Ga0500556_0000464
7580 Ga0500556_0002564
7581 Ga0500562_000982
7582 Ga0500572_001396
7583 Ga0500593_000113
7584 Ga0500595_000001
7585 Ga0500597_004998
7586 Ga0500608_000335
7587 Ga0500618_000208
7588 Ga0500618_002267
7589 Ga0500652_000043
7590 Ga0500652_001403
7591 Ga0500652_002919
7592 Ga0500659_0000299
7593 Ga0500559_0011613
7594 Ga0500559_0016502
7595 Ga0500568_0002023
7596 Ga0500568_0004635
7597 Ga0500568_0004934
7598 Ga0500586_001061
7599 Ga0500588_0000024
7600 Ga0500604_0001644
7601 Ga0500616_0000022
7602 Ga0500616_0000086
7603 Ga0500616_0000107
7604 Ga0500616_0000134
7605 Ga0500616_0000251
7606 Ga0500616_0000966
7607 Ga0500616_0003662
7608 Ga0500616_0003760
7609 Ga0500616_0004640
7610 Ga0500616_0012767
7611 Ga0500616_0019485
7612 Ga0500622_0000099
7613 Ga0500622_0000921
7614 Ga0500622_0002504
7615 Ga0500634_0000075
7616 Ga0500639_006934
7617 Ga0500645_001842
7618 Ga0500645_003213
7619 Ga0501084_0012694
7620 Ga0501084_0022118
7621 Ga0501084_0022822
7622 Ga0501084_0050434
7623 Ga0587083_0001695
7624 Ga0501082_0000591
7625 Ga0501082_0001915
7626 Ga0501082_0007904
7627 Ga0501082_0008454
7628 Ga0501082_0016400
7629 Ga0501082_0017932
7630 Ga0501082_0024787
7631 Ga0501082_0032072
7632 Ga0466962_0000777
7633 Ga0466962_0002135
7634 Ga0466962_0002886
7635 Ga0466962_0004954
7636 Ga0466962_0006958
7637 Ga0466962_0007174
7638 Ga0466962_0009005
7639 Ga0466962_0014019
7640 Ga0466962_0014139
7641 Ga0530510_0004801
7642 Ga0530510_0023103
7643 Ga0530510_0027753
7644 Ga0530510_0027964
7645 2688391182
7646 2501408791
7647 2506868021
7648 2508735307
7649 2509141189
7650 2509373582
7651 2510135950
7652 2510314003
7653 2511098504
7654 2511132780
7655 2511173108
7656 2511199771
7657 2511244903
7658 2511263899
7659 2511270331
7660 2511291270
7661 2511296531
7662 2511316548
7663 2511367934
7664 2511377306
7665 2511414453
7666 2512325096
7667 2512531293
7668 2512644987
7669 2512929094
7670 2513631178
7671 2513910524
7672 2513924079
7673 2513998976
7674 2515686530
7675 2515856853
7676 2516207066
7677 2517098014
7678 2517763598
7679 2519462082
7680 2521557174
7681 2522552883
7682 2523386283
7683 2523470626
7684 2524462007
7685 2525557747
7686 2528206775
7687 2528215531
7688 2546950733
7689 2547375571
7690 2547412577
7691 2548500897
7692 2548695915
7693 2555230129
7694 2555669696
7695 2558905841
7696 2558912712
7697 2559432977
7698 2563056186
7699 2566035028
7700 2566991490
7701 2572253488
7702 2579750620
7703 2583150239
7704 2583153447
7705 2583791351
7706 2585165058
7707 2585204524
7708 2585221503
7709 2585270417
7710 2585272507
7711 2585278307
7712 2585290958
7713 2585299496
7714 2585307426
7715 2585324851
7716 2585332331
7717 2585387749
7718 2585391824
7719 2585532036
7720 2585544327
7721 2585552396
7722 2585561429
7723 2585901950
7724 2585906658
7725 2585992755
7726 2586003465
7727 2586060823
7728 2587982079
7729 2588514632
7730 2595450271
7731 2596374444
7732 2596374837
7733 2597811112
7734 2599335238
7735 2599353302
7736 2599363699
7737 2599370019
7738 2599372326
7739 2599378410
7740 2599384213
7741 2599391185
7742 2599407430
7743 2599416124
7744 2599460136
7745 2599489157
7746 2599720766
7747 2600192797
7748 2600212745
7749 2600227621
7750 2600373400
7751 2601772913
7752 2601796135
7753 2606075012
7754 2606127875
7755 2616307825
7756 2616555178
7757 2616692956
7758 2617381850
7759 2623589860
7760 2624480181
7761 2624491325
7762 2630649339
7763 2643746287
7764 2643760656
7765 2643790959
7766 2643804514
7767 2643815383
7768 2643826963
7769 2643849995
7770 2643879430
7771 2643888499
7772 2643893016
7773 2643905007
7774 2643934837
7775 2643940060
7776 2643961925
7777 2643974332
7778 2643987989
7779 2644005401
7780 2644016216
7781 2644034213
7782 2644047541
7783 2644062806
7784 2644065527
7785 2644077116
7786 2644132546
7787 2644135997
7788 2644158159
7789 2644159321
7790 2644166917
7791 2644205989
7792 2644210671
7793 2644214885
7794 2644220606
7795 2644264965
7796 2644316324
7797 2644349431
7798 2644375483
7799 2644403066
7800 2644417129
7801 2644444188
7802 2644448119
7803 2644457092
7804 2644481008
7805 2644485578
7806 2644496683
7807 2644512081
7808 2644534310
7809 2644538450
7810 2644607355
7811 2644637844
7812 2644647692
7813 2644654205
7814 2644660727
7815 2644677666
7816 2644686728
7817 2644695430
7818 2644698087
7819 2645720679
7820 2645723698
7821 2655031156
7822 2671112849
7823 2676483915
7824 2676492611
7825 2686543993
7826 2688597638
7827 2689993326
7828 2691330261
7829 2691330359
7830 2692318627
7831 2694628954
7832 2694637131
7833 2707101941
7834 2710604720
7835 2713481705
7836 2715753510
7837 2715758423
7838 2718634536
7839 2725947090
7840 2729148048
7841 2734968223
7842 2738665407
7843 2738688350
7844 2738699031
7845 2738710006
7846 2738722058
7847 2738746413
7848 2738826357
7849 2738848431
7850 2738850420
7851 2738864160
7852 2738866149
7853 2738881148
7854 2738891248
7855 2739144541
7856 2739150154
7857 2739192073
7858 2739254747
7859 2739264082
7860 2739282422
7861 2739296678
7862 2739298667
7863 2739309564
7864 2739313172
7865 2739318550
7866 2739336791
7867 2739355643
7868 2739358356
7869 2739360345
7870 2740165474
7871 2743738657
7872 2746090175
7873 2746095615
7874 2748017221
7875 2753264521
7876 2753458085
7877 2756671923
7878 2765568301
7879 2765583291
7880 2770199545
7881 2774137993
7882 2774866674
7883 2774872249
7884 2774904389
7885 2778178321
7886 2784264933
7887 2784592518
7888 2785339346
7889 2785372131
7890 2786673218
7891 2792619574
7892 2792627346
7893 2792639759
7894 2792752118
7895 2793980354
7896 2793981964
7897 2795786098
7898 2795796877
7899 2807407941
7900 2807456244
7901 2808874051
7902 2808914153
7903 2808930198
7904 2808952237
7905 2808984924
7906 2809131812
7907 2809151376
7908 2809236147
7909 2809590183
7910 2812369071
7911 2812477024
7912 2817258198
7913 2817281388
7914 2817451938
7915 2819426512
7916 2819607953
7917 2819618669
7918 2819640281
7919 2819656849
7920 2819665522
7921 2819705516
7922 2819715059
7923 2819746570
7924 2821124431
7925 2821450611
7926 2829746121
7927 2830077595
7928 2831867815
7929 2837652113
7930 2838032790
7931 2838036246
7932 2838076019
7933 2838666523
7934 2838741076
7935 2839094839
7936 2840768777
7937 2841735579
7938 2841845027
7939 2842144749
7940 2842303323
7941 2842362046
7942 2842479522
7943 2842486934
7944 2842506812
7945 2842514983
7946 2842515173
7947 2842524717
7948 2842697146
7949 2842699043
7950 2842759410
7951 2842835316
7952 2842844135
7953 2842915533
7954 2842920616
7955 2842927138
7956 2843695685
7957 2844008133
7958 2844013026
7959 2844539659
7960 2844849914
7961 2846035388
7962 2846038920
7963 2847422873
7964 2847672560
7965 2848695136
7966 2848997724
7967 2852393557
7968 2852620856
7969 2852623756
7970 2852662142
7971 2852689185
7972 2855872628
7973 2856315788
7974 2856333536
7975 2856337941
7976 2856343859
7977 2856355380
7978 2856744560
7979 2857368954
7980 2857481908
7981 2857486103
7982 2857532011
7983 2858689534
7984 2862281594
7985 2862284092
7986 2862389898
7987 2863410611
7988 2863411053
7989 2866615240
7990 2867306672
7991 2867317437
7992 2867325145
7993 2867370823
7994 2867432112
7995 2867475435
7996 2868091048
7997 2869163871
7998 2869171315
7999 2869236764
8000 2869243458
8001 2869251109
8002 2869261635
8003 2869270551
8004 2869277963
8005 2870783685
8006 2871459549
8007 2871468303
8008 2871482686
8009 2873316820
8010 2874112020
8011 2874118176
8012 2874126860
8013 2874139080
8014 2874165362
8015 2875392423
8016 2876369560
8017 2876374855
8018 2876386397
8019 2876402898
8020 2876408753
8021 2876426679
8022 2877678496
8023 2878032091
8024 2878042402
8025 2878777576
8026 2878784403
8027 2878795734
8028 2879164082
8029 2880233026
8030 2881103836
8031 2881154587
8032 2881158354
8033 2881857405
8034 2882634251
8035 2883095962
8036 2883825358
8037 2884411998
8038 2884937337
8039 2885318755
8040 2885345191
8041 2885358009
8042 2885384202
8043 2886631199
8044 2886854132
8045 2887484068
8046 2887631427
8047 2888346355
8048 2889013725
8049 2889021567
8050 2889307461
8051 2889419146
8052 2891329380
8053 2891376023
8054 2891402076
8055 2891561247
8056 2891565996
8057 2891675061
8058 2894511696
8059 2894776267
8060 2895436738
8061 2896388399
8062 2897564345
8063 2899374008
8064 2899375960
8065 2900634762
8066 2902690551
8067 2902797419
8068 2902816581
8069 2902843377
8070 2903453148
8071 2903518756
8072 2903526838
8073 2903530171
8074 2904433075
8075 2904437872
8076 2904440118
8077 2904523412
8078 2904530946
8079 2904541015
8080 2904587421
8081 2904592544
8082 2904604665
8083 2904695528
8084 2906364793
8085 2906377213
8086 2906389445
8087 2906398415
8088 2906402416
8089 2906412519
8090 2906415925
8091 2906633442
8092 2906799945
8093 2911140803
8094 2911141828
8095 2912715991
8096 2912727067
8097 2912761124
8098 2913298804
8099 2915361759
8100 2915769932
8101 2916179021
8102 2916973990
8103 2917073515
8104 2917741930
8105 2917743739
8106 2919038156
8107 2919039710
8108 2919050475
8109 2919053574
8110 2919068564
8111 2919082495
8112 2919085849
8113 2919103591
8114 2919130444
8115 2919176099
8116 2919386919
8117 2919406818
8118 2919412635
8119 2919427950
8120 2919449232
8121 2919462214
8122 2919478760
8123 2919492927
8124 2919516490
8125 2919535424
8126 2919678630
8127 2919691414
8128 2919697584
8129 2919701165
8130 2919705603
8131 2920826884
8132 2921646769
8133 2921652285
8134 2922152034
8135 2922175855
8136 2922560659
8137 2923157722
8138 2923523152
8139 2924741143
8140 2924752687
8141 2928027564
8142 2928030764
8143 2928101705
8144 2928103520
8145 2928125547
8146 2928133407
8147 2928163479
8148 2928167007
8149 2928531075
8150 2928531475
8151 2928959795
8152 2928962937
8153 2928972251
8154 2929186693
8155 2929198549
8156 2929200736
8157 2935357475
8158 2936344140
8159 2937842390
8160 2937851493
8161 2937863387
8162 2937868991
8163 2939588680
8164 2939651309
8165 2941489533
8166 2941490968
8167 2945910284
8168 2945917388
8169 2945922390
8170 2945962790
8171 2945972574
8172 2945987675
8173 2946052388
8174 2947232892
8175 2952256077
8176 2953995905
8177 2954007476
8178 2954383454
8179 2954679518
8180 2954684638
8181 2954692045
8182 2954694232
8183 2954707112
8184 2954709345
8185 2954713765
8186 2954723732
8187 2954738104
8188 2954742632
8189 2954756962
8190 2954761596
8191 2958075426
8192 2958103867
8193 2958110095
8194 2958124137
8195 2958141672
8196 2958173381
8197 2961132986
8198 2961187176
8199 2963650140
8200 2965025829
8201 2965040581
8202 2965094347
8203 2965105126
8204 2965122794
8205 2965323670
8206 2968086514
8207 2968141572
8208 2969307021
8209 2970493423
8210 2970511186
8211 2970527862
8212 2970536008
8213 2970543158
8214 2970551522
8215 2970623283
8216 2970627573
8217 2974291567
8218 2974305396
8219 2977852190
8220 2977868287
8221 2977878034
8222 2977909840
8223 2977917884
8224 2977923210
8225 2977939068
8226 2977954720
8227 2977963826
8228 2977992488
8229 2979769113
8230 2980182931
8231 2981996710
8232 2984556514
8233 2984558143
8234 2984565314
8235 2984567489
8236 2984594202
8237 2987645653
8238 2987655465
8239 2990048764
8240 2990061001
8241 2990064426
8242 2990089721
8243 2990198240
8244 2993356388
8245 2993358543
8246 2995726344
8247 2995950029
8248 2996388529
8249 2997455568
8250 2997605309
8251 2998142213
8252 2998346635
8253 3001121477
8254 3003000273
8255 3003666444
8256 3004168068
8257 3004213500
8258 3004221213
8259 3004236343
8260 3004244353
8261 3004253998
8262 3005421196
8263 3005457628
8264 3006399744
8265 3006488829
8266 3007619280
8267 3007723363
8268 3007806952
8269 3007856425
8270 3007862526
8271 3007872207
8272 637879256
8273 637078814
8274 637320029
8275 639788145
8276 640487582
8277 642418220
8278 643823114
8279 649872182
8280 651175527
8281 8001526165
8282 8001787490
8283 8002288242
8284 8002790263
8285 8002872654
8286 8004306926
8287 8004362786
8288 8004636452
8289 8004702412
8290 8004728556
8291 8005319069
8292 8005489610
8293 8005559321
8294 8005565359
8295 8005650471
8296 8005684126
8297 8006929814
8298 8008486124
8299 8008564640
8300 8008575385
8301 8011353693
8302 8015559291
8303 8018154278
8304 8018165682
8305 8019778233
8306 8020813528
8307 8023629231
8308 8025525440
8309 8025534226
8310 8029998490
8311 8036739285
8312 8040167289
8313 8040179087
8314 8047715684
8315 8047894611
8316 8047902342
8317 8048134939
8318 8048364441
8319 8048370138
8320 8048371629
8321 8048380562
8322 8048390131
8323 8048411283
8324 8052497913
8325 8053948389
8326 8054304460
8327 8054360236
8328 8054477552
8329 8054479083
8330 8054931778
8331 8055067990
8332 8055175039
8333 8055619154
8334 8055775043
8335 8055913953
8336 8056061242
8337 8056122867
8338 8056139868
8339 8056168856
8340 8056173882
8341 8056574252
8342 8056694159
8343 8056834704
8344 8057102869
8345 8057474809
8346 8057571114
8347 8057579750
8348 8057634510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00141

peroxidase

Peroxidase

153

480

0.88

PF00141

peroxidase

Peroxidase

487

793

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5syi-assembly1.cif.gz_A structure of d141a variant of b. pseudomallei katg complexed with inh 0.9836 26 720
5sxx-assembly1.cif.gz_A crystal structure of the e198a variant of burkholderia pseudomallei catalase-peroxidase katg with inh 0.9834 24 720
5v53-assembly1.cif.gz_A crystal structure of the d141a/q233e/n240d variant of catalase-peroxidase from b. pseudomallei with acetate bound 0.9833 24 720
5sx1-assembly1.cif.gz_A crystal structure of d141e variant of b. pseudomallei katg 0.9833 24 720
6cfq-assembly1.cif.gz_B crystal structure of the d141n variant of catalase-peroxidase from b. pseudomallei with inh bound 0.9827 26 720
ID Description Score Start End Superfamily
1sj2B01 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.9954 58 185 1.10.520.10
1mwvA03 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.9944 418 573 1.10.520.10
1itkA01 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.9943 58 184 1.10.520.10
2fxhA01 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.9821 22 190 1.10.520.10
3uw8A02 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 2;Peroxidase, domain 2 0.9817 227 394 1.10.420.10
ID Description Score Start End GO Terms
AF-A0A4S1FRP7-F1-model_v4 Catalase-peroxidase 1.003 66 161 GO:0004096
GO:0005829
GO:0020037
GO:0042744
GO:0046872
GO:0070301
AF-A0A3C0ITM8-F1-model_v4 Catalase-peroxidase 0.9982 450 570 GO:0004096
GO:0005829
GO:0020037
GO:0042744
GO:0070301
AF-T1BKY8-F1-model_v4 Heme peroxidase, plant/fungal/bacterial (EC 1.11.1.-) 0.9977 426 563 GO:0004096
GO:0005829
GO:0020037
GO:0042744
GO:0070301
AF-A0A8B4PR04-F1-model_v4 deleted 0.9976 238 339
AF-A0A7Y0R142-F1-model_v4 Catalase-peroxidase 0.9968 35 185 GO:0004096
GO:0005829
GO:0020037
GO:0042744
GO:0046872
GO:0070301

Map